DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Prosalpha2 and Prosalpha6T

Sequence 1:NP_524328.1 Gene:Prosalpha2 FlyBaseID:FBgn0086134 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_609623.1 Gene:Prosalpha6T FlyBaseID:FBgn0032492 Length:289 Species:Drosophila melanogaster

Alignment Length:214 Identity:67/215 (31%)
Similarity:113/215 (53%) Gaps:14/215 (7%)


  Fly     1 MATERYSFSLTTFSPSGKLVQLEYALAAVSGGAPSVGIIASNGVVIAT---ENKHKSPLYEQHSV 62
            |...:|....||:||.|:|.|:|||:.||..||.:||:..::..|:|.   .:|..:.|  |..:
  Fly     1 MFRNQYDNDTTTWSPQGRLFQVEYAMEAVKQGAATVGLKGTDYAVLAALCRTSKDTNTL--QRKI 63

  Fly    63 HRVEMIYNHIGMVYSGMGPDYRLLVKQARKIAQTYYLTYKEPIPVSQLVQRVATLMQEYTQSGGV 127
            ..|:   :|:||..:|:..|.|::.:..|.....|..:|....||.:||..:...:|..||....
  Fly    64 MPVD---DHVGMSIAGLTADARVVCQYMRTECMAYRHSYNAEFPVRRLVSNLGNKLQTTTQRYDR 125

  Fly   128 RPFGVSLLICGWDNDRPYLYQSDPSGAYFAWKATAMGKNAVNGKTFLEKRYS--EDLELDDAVHT 190
            ||:||.||:.|:|...|::||..|:......||.|:|..:.:.:|:||:...  ||.::|:.:..
  Fly   126 RPYGVGLLVAGYDEQGPHIYQVMPTANVLNCKAMAIGSRSQSARTYLERNMESFEDCDMDELICH 190

  Fly   191 AILTLKEGFEGKMTADNIE 209
            ||    :...|.:.:|::|
  Fly   191 AI----QAIRGSLGSDDVE 205

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Prosalpha2NP_524328.1 PRK03996 6..233 CDD:235192 66/210 (31%)
proteasome_alpha_type_2 6..231 CDD:239719 66/210 (31%)
Prosalpha6TNP_609623.1 PRE1 4..233 CDD:223711 66/212 (31%)
proteasome_alpha_type_1 6..215 CDD:239718 66/210 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C78984039
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11599
RoundUp 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.