DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Prosalpha2 and Prosbeta4R2

Sequence 1:NP_524328.1 Gene:Prosalpha2 FlyBaseID:FBgn0086134 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_001259950.1 Gene:Prosbeta4R2 FlyBaseID:FBgn0031443 Length:210 Species:Drosophila melanogaster

Alignment Length:206 Identity:40/207 (19%)
Similarity:90/207 (43%) Gaps:26/207 (13%)


  Fly    36 VGIIASNGVVIATENKHKSPLY----EQHSVHRVEMIYNHIGMVYSG----MGPDYRLLVKQARK 92
            :||...:.|::|::......|.    :|..:||:. .:|.:..|..|    ...|:........|
  Fly     7 LGIKGPDFVMLASDTMQAKSLVFMKDDQSKIHRLS-DFNMMATVGDGGDTIQFTDFISKNLHLYK 70

  Fly    93 IAQTYYLTYKEPIPVSQLVQRVATLMQEYTQSGGVRPFGVSLLICGWDN-DRPYLYQSDPSGAYF 156
            |:..|:|:.|.....::  :.:|..::..|:      :.|::|:.|:|. :.|.|:..|..||..
  Fly    71 ISHGYHLSAKSAAHFTR--KTLADYIRTNTR------YQVAMLLAGYDAVEGPDLHYIDSYGAAQ 127

  Fly   157 AWKATAMGKNAVNGKTFLEKRYSEDLELDDA---VHTAILTLKEGFEGKMTADNIEIGICDQNGF 218
            :......|..::...:.|::.::..|..:||   :...:|.::...  .:...|.|:.:.|..|.
  Fly   128 SINHAGHGWGSMFCGSILQRYWNSKLSQEDAYSLMKKCVLEIQRRL--IINQRNFEVYVVDSKGM 190

  Fly   219 QRLD---PASI 226
            ::::   |.|:
  Fly   191 RKMEAINPGSL 201

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Prosalpha2NP_524328.1 PRK03996 6..233 CDD:235192 40/207 (19%)
proteasome_alpha_type_2 6..231 CDD:239719 40/207 (19%)
Prosbeta4R2NP_001259950.1 PRE1 1..194 CDD:223711 38/198 (19%)
proteasome_beta_type_2 3..194 CDD:239727 38/198 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C79032153
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11599
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.