DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Prosalpha2 and Prosbeta4R1

Sequence 1:NP_524328.1 Gene:Prosalpha2 FlyBaseID:FBgn0086134 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_608698.2 Gene:Prosbeta4R1 FlyBaseID:FBgn0031442 Length:215 Species:Drosophila melanogaster

Alignment Length:212 Identity:49/213 (23%)
Similarity:93/213 (44%) Gaps:27/213 (13%)


  Fly    36 VGIIASNGVVIATEN-KHKSPLYEQHSVHRVEMIYNHIGMVYSGMG------PDYRLLVKQARKI 93
            :|:..::.:::|::. ::||.::....|.:...|.::..|..:|.|      .|:.|......||
  Fly     5 LGVKGTDFIILASDTMRNKSAMWLDDEVRKTHRISDYCMMSTAGDGGDCLKFSDFILRNMDLYKI 69

  Fly    94 AQTYYLTYKEPIPVSQLVQRVATLMQEYTQSGGVRPFGVSLLICGWD-NDRPYLYQSDPSGAYFA 157
            ...|.||      |...|..:...:..|.:|...  |.||||:.|:| ...|.|:..|..|....
  Fly    70 TNGYDLT------VRGAVHFIRRHLSAYLKSDCT--FQVSLLVGGYDLTSGPELHYIDYLGNSVP 126

  Fly   158 WKATAMGKNAVNGKT-FLEKRYSEDLELD---DAVHTAILTLKEGFEGKMTADNIEIGICDQNGF 218
            .:....|. |:|..| .||:.|..|::..   |.:...::.|.:.|  .:...||::.:..:||.
  Fly   127 VRYGGHGA-AMNFCTPILEEFYKPDMDTQAAYDVIKKCVIELYKRF--VINLRNIDLFLISKNGI 188

  Fly   219 QRLDPASIK----DYLA 231
            .:::..:::    |.||
  Fly   189 TKMNSINLESLRGDILA 205

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Prosalpha2NP_524328.1 PRK03996 6..233 CDD:235192 49/213 (23%)
proteasome_alpha_type_2 6..231 CDD:239719 48/211 (23%)
Prosbeta4R1NP_608698.2 PRE1 1..204 CDD:223711 47/210 (22%)
proteasome_beta_type_2 1..193 CDD:239727 46/199 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C79032187
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11599
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.