| Sequence 1: | NP_524328.1 | Gene: | Prosalpha2 / 41531 | FlyBaseID: | FBgn0086134 | Length: | 234 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_608698.2 | Gene: | Prosbeta4R1 / 33449 | FlyBaseID: | FBgn0031442 | Length: | 215 | Species: | Drosophila melanogaster |
| Alignment Length: | 212 | Identity: | 49/212 - (23%) |
|---|---|---|---|
| Similarity: | 93/212 - (43%) | Gaps: | 27/212 - (12%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 36 VGIIASNGVVIATEN-KHKSPLYEQHSVHRVEMIYNHIGMVYSGMG------PDYRLLVKQARKI 93
Fly 94 AQTYYLTYKEPIPVSQLVQRVATLMQEYTQSGGVRPFGVSLLICGWD-NDRPYLYQSDPSGAYFA 157
Fly 158 WKATAMGKNAVNGKT-FLEKRYSEDLELD---DAVHTAILTLKEGFEGKMTADNIEIGICDQNGF 218
Fly 219 QRLDPASIK----DYLA 231 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Prosalpha2 | NP_524328.1 | proteasome_alpha_type_2 | 6..231 | CDD:239719 | 47/210 (22%) |
| Prosbeta4R1 | NP_608698.2 | PRE1 | 1..204 | CDD:223711 | 47/209 (22%) |
| proteasome_beta_type_2 | 1..193 | CDD:239727 | 46/198 (23%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C45441056 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | P | PTHR11599 |
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 2.030 | |||||