DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Prosalpha2 and Prosalpha4

Sequence 1:NP_524328.1 Gene:Prosalpha2 FlyBaseID:FBgn0086134 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_525092.1 Gene:Prosalpha4 FlyBaseID:FBgn0004066 Length:249 Species:Drosophila melanogaster

Alignment Length:236 Identity:86/237 (36%)
Similarity:141/237 (59%) Gaps:8/237 (3%)


  Fly     3 TERYSFSLTTFSPSGKLVQLEYALAAVSGGAPSVGIIASNGVVIATENKHKSPLYEQHSVHRVEM 67
            :.||..::|.|||.|.|:|:|||..||..|:.:||:..:|.||:..|.|..:.|.|...|.::.|
  Fly     2 SSRYDRAVTIFSPDGHLLQVEYAQEAVRKGSTAVGVRGANCVVLGVEKKSVAQLQEDRKVRKICM 66

  Fly    68 IYNHIGMVYSGMGPDYRLLVKQARKIAQTYYLTYKEPIPVSQLVQRVATLMQEYTQSGGVRPFGV 132
            :.||:.|.::|:..|.|:::.:|:...|::.|..::|:.:..:.:.:|.|.|:||||.|.||||:
  Fly    67 LDNHVVMAFAGLTADARIMINRAQVECQSHRLNVEDPVTLEYITRFIAQLKQKYTQSNGRRPFGI 131

  Fly   133 SLLICGWDND-RPYLYQSDPSGAYFAWKATAMGKNAVNGKTFLEKRYSEDLELDD--AVHTAILT 194
            |.||.|:|.| ..:|:|::|||.::.:||.|.|::|...:.|.||.|.|:...::  ||..||..
  Fly   132 SCLIGGFDADGSAHLFQTEPSGIFYEYKANATGRSAKVVREFFEKSYREEEVANEHGAVKLAIRA 196

  Fly   195 LKEGFEGKMTADNIEIGICDQNG--FQRLDPASIKDYLASI 233
            |.|  ..:...:|:|:.|. :||  .:.||...|.||:..|
  Fly   197 LLE--VAQSGQNNLEVAIM-ENGKPLKMLDTDVITDYVKII 234

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Prosalpha2NP_524328.1 PRK03996 6..233 CDD:235192 84/232 (36%)
proteasome_alpha_type_2 6..231 CDD:239719 84/230 (37%)
Prosalpha4NP_525092.1 PRK03996 5..231 CDD:235192 84/229 (37%)
proteasome_alpha_type_7 5..213 CDD:239724 77/210 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C78938331
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11599
RoundUp 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.