DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha2 and Prosbeta2R1

DIOPT Version :9

Sequence 1:NP_524328.1 Gene:Prosalpha2 / 41531 FlyBaseID:FBgn0086134 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_572267.1 Gene:Prosbeta2R1 / 31511 FlyBaseID:FBgn0029812 Length:307 Species:Drosophila melanogaster


Alignment Length:202 Identity:43/202 - (21%)
Similarity:81/202 - (40%) Gaps:15/202 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 AVSGGAPSVGIIASNGVVIATENK-HKSPLYEQHSVHRVEMIYNHIGMVYSGMGPDYRLLVKQAR 91
            |:..|...||||..:||::..:.: .:.|:....:..::..:.:||....:|...|..::.....
  Fly    44 AIKTGTSIVGIIYKDGVILGADTRATEGPIVSDKNCSKIHHLQDHIYCCGAGTAADTEMITLTTS 108

  Fly    92 KIAQTYYLTYKEPIPV---SQLVQRVATLMQEYTQSGGVRPFGVSLLICGWDNDRPYLYQSDPSG 153
            .....:.|..:..:||   |.:::|.....|.:        .|.:|::.|.|...|.||...|.|
  Fly   109 AELDLHRLNTERRVPVVCASMMLRRTLFRYQGH--------IGAALVMGGVDTTGPQLYCIYPCG 165

  Fly   154 AYFAWKATAMGKNAVNGKTFLEKRYSEDLELDDAVHTAILTLKEG-FEGKMTADNIEIGICDQNG 217
            :.......|||...:...:.||..:..||:|:.........:..| |....:..||::.:....|
  Fly   166 SNDKIPYAAMGSGTLAAMSVLEHGWKPDLDLEQGKQLVREAISAGVFNDLGSGSNIDLCVITAKG 230

  Fly   218 --FQRLD 222
              :.|.|
  Fly   231 AVYLRTD 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha2NP_524328.1 proteasome_alpha_type_2 6..231 CDD:239719 43/202 (21%)
Prosbeta2R1NP_572267.1 20S_bact_beta 48..241 CDD:163402 42/198 (21%)
proteasome_beta_type_7 49..236 CDD:239732 39/194 (20%)
Pr_beta_C 241..274 CDD:289249
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441066
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.