DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Prosalpha2 and Prosbeta2R1

Sequence 1:NP_524328.1 Gene:Prosalpha2 FlyBaseID:FBgn0086134 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_572267.1 Gene:Prosbeta2R1 FlyBaseID:FBgn0029812 Length:307 Species:Drosophila melanogaster

Alignment Length:202 Identity:43/203 (21%)
Similarity:81/203 (40%) Gaps:15/203 (7%)


  Fly    28 AVSGGAPSVGIIASNGVVIATENK-HKSPLYEQHSVHRVEMIYNHIGMVYSGMGPDYRLLVKQAR 91
            |:..|...||||..:||::..:.: .:.|:....:..::..:.:||....:|...|..::.....
  Fly    44 AIKTGTSIVGIIYKDGVILGADTRATEGPIVSDKNCSKIHHLQDHIYCCGAGTAADTEMITLTTS 108

  Fly    92 KIAQTYYLTYKEPIPV---SQLVQRVATLMQEYTQSGGVRPFGVSLLICGWDNDRPYLYQSDPSG 153
            .....:.|..:..:||   |.:::|.....|.:        .|.:|::.|.|...|.||...|.|
  Fly   109 AELDLHRLNTERRVPVVCASMMLRRTLFRYQGH--------IGAALVMGGVDTTGPQLYCIYPCG 165

  Fly   154 AYFAWKATAMGKNAVNGKTFLEKRYSEDLELDDAVHTAILTLKEG-FEGKMTADNIEIGICDQNG 217
            :.......|||...:...:.||..:..||:|:.........:..| |....:..||::.:....|
  Fly   166 SNDKIPYAAMGSGTLAAMSVLEHGWKPDLDLEQGKQLVREAISAGVFNDLGSGSNIDLCVITAKG 230

  Fly   218 --FQRLD 222
              :.|.|
  Fly   231 AVYLRTD 237

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Prosalpha2NP_524328.1 PRK03996 6..233 CDD:235192 43/203 (21%)
proteasome_alpha_type_2 6..231 CDD:239719 43/203 (21%)
Prosbeta2R1NP_572267.1 20S_bact_beta 48..241 CDD:163402 42/199 (21%)
proteasome_beta_type_7 49..236 CDD:239732 40/195 (21%)
Pr_beta_C 241..274 CDD:289249
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C79056389
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11599
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.