DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Prosalpha2 and pas-2

Sequence 1:NP_524328.1 Gene:Prosalpha2 FlyBaseID:FBgn0086134 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_505750.1 Gene:pas-2 WormBaseID:WBGene00003923 Length:231 Species:Caenorhabditis elegans

Alignment Length:232 Identity:140/233 (60%)
Similarity:172/233 (74%) Gaps:5/233 (2%)


  Fly     4 ERYSFSLTTFSPSGKLVQLEYALAAVSGGAPSVGIIASNGVVIATENKHKSPLYEQHSVHRVEMI 68
            :.|.||||||||||||:|:||||.||..|.||||:.|.:|||:||||.......:|   .:||.|
 Worm     3 DHYGFSLTTFSPSGKLMQIEYALNAVKNGQPSVGLRAKDGVVLATENVGSVLTDDQ---PKVEQI 64

  Fly    69 YNHIGMVYSGMGPDYRLLVKQARKIAQTYYLTYKEPIPVSQLVQRVATLMQEYTQSGGVRPFGVS 133
            ..|||.||||||||:|:|||:|||||..|.:.|.|.:|..|||..:|.:||||||||||||||.|
 Worm    65 SKHIGCVYSGMGPDFRILVKKARKIAMEYEMMYGEEMPTIQLVTDIAAVMQEYTQSGGVRPFGAS 129

  Fly   134 LLICGWDND--RPYLYQSDPSGAYFAWKATAMGKNAVNGKTFLEKRYSEDLELDDAVHTAILTLK 196
            |||.|||.:  ||.|:|.|||||||||||||:|||.||.|||||||:||.|||||.:|||:|||:
 Worm   130 LLIAGWDKNPGRPLLFQCDPSGAYFAWKATALGKNDVNAKTFLEKRFSEALELDDGIHTALLTLR 194

  Fly   197 EGFEGKMTADNIEIGICDQNGFQRLDPASIKDYLASI 233
            |.|:..|..:|:|:.:|:..||.||....:.|:|.::
 Worm   195 ESFDVGMNENNVEVAVCNSTGFHRLTKQQVHDHLGTL 231

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Prosalpha2NP_524328.1 PRK03996 6..233 CDD:235192 140/229 (61%)
proteasome_alpha_type_2 6..231 CDD:239719 140/227 (62%)
pas-2NP_505750.1 proteasome_alpha_type_2 5..229 CDD:239719 140/227 (62%)
PRK03996 10..228 CDD:235192 135/221 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C273169630
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 1 1.000 H2081
Inparanoid 1 1.050 279 1.000 Inparanoid score I1744
Isobase 1 0.950 0 Normalized mean entropy S257
OMA 1 1.010
OrthoDB 1 1.010 D1222564at2759
OrthoFinder 1 1.000 FOG0003366
OrthoInspector 1 1.000 T477351
orthoMCL 1 0.900 OOG5_127791
Panther 1 1.100 LDO PTHR11599
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1004
TreeFam 00.000 Not matched by this tool.
1312.890

Return to query results.
Submit another query.