DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Prosalpha2 and pas-5

Sequence 1:NP_524328.1 Gene:Prosalpha2 FlyBaseID:FBgn0086134 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_492765.1 Gene:pas-5 WormBaseID:WBGene00003926 Length:248 Species:Caenorhabditis elegans

Alignment Length:246 Identity:74/247 (30%)
Similarity:130/247 (53%) Gaps:13/247 (5%)


  Fly     1 MATERYSFSLTTFSPSGKLVQLEYALAAVSGGAPSVGIIASNGVVIATENKHKSPLYEQHSVHRV 65
            :....|...:.||||.|:|.|:|||:.||..|:.|:||..|.||::|.|.:..|.|....::.::
 Worm     3 LTRSEYDRGVNTFSPEGRLFQVEYAIEAVKLGSTSIGIKTSEGVLLAAEKRSTSKLMVNDAIEKI 67

  Fly    66 EMIYNHIGMVYSGMGPDYRLLVKQARKIAQTYYLTYKEPIPVSQLVQRVATLMQEY----TQSGG 126
            ..:..|||:.::|:..|.|.||::|:..||.::.||...|.|..:.|.||.|..::    .::..
 Worm    68 SKVDQHIGVTFAGLIADSRTLVERAQIEAQNFWFTYNRKIRVEDVTQSVANLALQFGDDDVKASM 132

  Fly   127 VRPFGVSLLICGWDNDRPYLYQSDPSGAYFAWKATAMGKNAVNGKTFLEKRYSEDLELDDAVHTA 191
            .|||||::|..|.|.:...|:..||||.:...||.::|..:...:..|:::|.:.|.:.:.:..|
 Worm   133 SRPFGVAMLFAGVDQEGAKLFHLDPSGTFIDCKAKSIGAASDGAEQNLKEQYHDALTIKEGLKMA 197

  Fly   192 ILTLKEGFEGKMTADNIEIGI----CDQNG-----FQRLDPASIKDYLASI 233
            :..||:..|.|:.:.|:|:.:    .|..|     |.|:....:...:.|:
 Worm   198 LAILKQVMEEKLNSANVEVVVIKPTVDAKGRPIGEFTRVSNEELDQVITSL 248

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Prosalpha2NP_524328.1 PRK03996 6..233 CDD:235192 74/240 (31%)
proteasome_alpha_type_2 6..231 CDD:239719 73/238 (31%)
pas-5NP_492765.1 PRK03996 8..248 CDD:235192 74/240 (31%)
proteasome_alpha_type_5 8..219 CDD:239722 69/211 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.