DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Prosalpha2 and PSMA8

Sequence 1:NP_524328.1 Gene:Prosalpha2 FlyBaseID:FBgn0086134 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_653263.2 Gene:PSMA8 HGNCID:22985 Length:256 Species:Homo sapiens

Alignment Length:243 Identity:97/244 (40%)
Similarity:144/244 (59%) Gaps:20/244 (8%)


  Fly     5 RYSFSLTTFSPSGKLVQLEYALAAVSGGAPSVGIIASNGVVIATENKHKSPLYEQHSVHRVEMIY 69
            ||..::|.|||.|.|.|:|||..||..|:.:|||..:|.||:..|.|..:.|.::.:|.::..:.
Human     4 RYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGIRGTNIVVLGVEKKSVAKLQDERTVRKICALD 68

  Fly    70 NHIGM------VYSGMGPDYRLLVKQARKIAQTYYLTYKEPIPVSQLVQRVATLMQEYTQSGGVR 128
            :|:.|      ::.|:..|.|:::.:||...|::.||.::|:.|..:.:.:|||.|:||||.|.|
Human    69 DHVCMAFAVLTIFIGLTADARVVINRARVECQSHKLTVEDPVTVEYITRFIATLKQKYTQSNGRR 133

  Fly   129 PFGVSLLICGWDNDR-PYLYQSDPSGAYFAWKATAMGKNAVNGKTFLEKRYSEDLELDD--AVHT 190
            |||:|.||.|:|:|. ..|||:||||.|.||||.|:|::|...:.||||.|:||....|  |:..
Human   134 PFGISALIVGFDDDGISRLYQTDPSGTYHAWKANAIGRSAKTVREFLEKNYTEDAIASDSEAIKL 198

  Fly   191 AILTLKEGFE--GKMTADNIEIGICDQNGFQRLDPASIKD---YLASI 233
            ||..|.|..:  ||    |||:.|..:|  |.|...|.|:   |:..|
Human   199 AIKALLEVVQSGGK----NIELAIIRRN--QPLKMFSAKEVELYVTEI 240

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Prosalpha2NP_524328.1 PRK03996 6..233 CDD:235192 95/241 (39%)
proteasome_alpha_type_2 6..231 CDD:239719 95/239 (40%)
PSMA8NP_653263.2 PRK03996 5..237 CDD:235192 95/238 (40%)
proteasome_alpha_type_7 5..219 CDD:239724 89/218 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.