DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5245 and ZNF561

DIOPT Version :8

Sequence 1:NP_650197.1 Gene:CG5245 / 41530 FlyBaseID:FBgn0038047 Length:501 Species:Drosophila melanogaster
Sequence 2:XP_024307548.1 Gene:ZNF561 / 93134 HGNCID:28684 Length:502 Species:Homo sapiens

Alignment Length:484 Identity:145/485 (30%)
Similarity:232/485 (48%) Gaps:67/485 (14%)


  Fly    13 DEPPQE----DTFEEELIFISNSDFEELESEIKIENFCSYGK---DLEPVKGVPSKLKT--CKSK 68
            |..|:|    ||.|:.|.           .::.:||:.:...   :::| :...|.|:.  .|::
Human    65 DFTPEEWALLDTTEKYLY-----------RDVMLENYMNLASVEWEIQP-RTKRSSLQQGFLKNQ 117

  Fly    69 IAKKRPLRKQTDTFK---CTQCQKTFTRKENLESHLRLHAEERPFECSHCSKSFGRRTHYKRHLL 130
            |.....:.:....:|   |..|.:.|..:..|::|:|:.......| .:|   :|:.|     |.
Human   118 IFSGIQMTRGYSGWKLCDCKNCGEVFREQFCLKTHMRVQNGGNTSE-GNC---YGKDT-----LS 173

  Fly   131 KHEKRP-----HKCSHCSKTFTQNSSLKQHLHEHTGERPFKCTQCSTSFARKSHLQVHLRTHSEE 190
            .|::..     .|.:.|.|.||....|..||......:|:||.:|...|...:.|..|:..|::|
Human   174 VHKEASTGQELSKFNPCGKVFTLTPGLAVHLEVLNARQPYKCKECGKGFKYFASLDNHMGIHTDE 238

  Fly   191 RPFECTHCEKAFKNNSHLQEHLRTHQEARPFKCSHCSKSFKLRSILQKHLLTH-AERSFKCTQCP 254
            :..|.....:|...:|||::.:..|...:..|...|.|||...|.|...:.|| .|:||:|.:|.
Human   239 KLCEFQEYGRAVTASSHLKQCVAVHTGKKSKKTKKCGKSFTNFSQLYAPVKTHKGEKSFECKECG 303

  Fly   255 KTFLQNDSLQIHLRVHAGEDPFKCPHCSETFARNSRLQLHLLEHAGKEPLKCSQCSATFAMRSLY 319
            ::|..:..|..|:::|.|..|.||.:|.:.|.|:::|..|:..|.|.:|.:|.:|...||..|..
Human   304 RSFRNSSCLNDHIQIHTGIKPHKCTYCGKAFTRSTQLTEHVRTHTGIKPYECKECGQAFAQYSGL 368

  Fly   320 RVHVRLHTRERQYKCAECSKSFFKKSHLVEHQQVHTGERPFKCTHCFKDFKCRTHLRVHMLDHIG 384
            .:|:|.|:.::.|:|.||.|:|...:.|::|.::||||:|::|..                    
Human   369 SIHIRSHSGKKPYQCKECGKAFTTSTSLIQHTRIHTGEKPYECVE-------------------- 413

  Fly   385 EKVPKCSYCSKEFKLSSQLLVHLQEHTGKNQFECPHCSKSYTTSSTLHMHLRTHTGELPFKCSHC 449
                    |.|.|..||:...||:.|:|:..|.|..|.|::..||.|::||||||||.||.|..|
Human   414 --------CGKTFITSSRRSKHLKTHSGEKPFVCKICGKAFLYSSRLNVHLRTHTGEKPFVCKEC 470

  Fly   450 SKLFARSAEHQEHLRTHTGEKPYKCSHCS 478
            .|.||.|:....|.|.|||||||:|...|
Human   471 GKAFAVSSRLSRHERIHTGEKPYECKDMS 499

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5245NP_650197.1 COG5048 74..478 CDD:227381 130/413 (31%)
C2H2 Zn finger 84..104 CDD:275368 6/20 (30%)
C2H2 Zn finger 112..132 CDD:275368 4/20 (20%)
C2H2 Zn finger 139..159 CDD:275368 7/20 (35%)
C2H2 Zn finger 167..187 CDD:275368 5/20 (25%)
zf-H2C2_2 179..204 CDD:290200 6/25 (24%)
C2H2 Zn finger 195..215 CDD:275368 4/20 (20%)
C2H2 Zn finger 223..243 CDD:275368 7/20 (35%)
C2H2 Zn finger 250..270 CDD:275368 5/20 (25%)
C2H2 Zn finger 278..298 CDD:275368 6/20 (30%)
C2H2 Zn finger 306..326 CDD:275368 7/20 (35%)
C2H2 Zn finger 334..354 CDD:275368 7/20 (35%)
C2H2 Zn finger 362..382 CDD:275368 1/20 (5%)
C2H2 Zn finger 390..410 CDD:275368 7/20 (35%)
C2H2 Zn finger 418..438 CDD:275368 10/20 (50%)
C2H2 Zn finger 446..466 CDD:275368 8/20 (40%)
C2H2 Zn finger 474..492 CDD:275368 2/6 (33%)
ZNF561XP_024307548.1 KRAB 56..96 CDD:307490 9/42 (21%)
C2H2 Zn finger 190..207 CDD:275370 7/17 (41%)
C2H2 Zn finger 215..235 CDD:275368 5/20 (25%)
C2H2 Zn finger 243..263 CDD:275368 4/20 (20%)
COG5048 <287..483 CDD:227381 77/224 (34%)
C2H2 Zn finger 299..319 CDD:275368 5/20 (25%)
C2H2 Zn finger 327..347 CDD:275368 6/20 (30%)
C2H2 Zn finger 355..375 CDD:275368 7/20 (35%)
C2H2 Zn finger 383..403 CDD:275368 7/20 (35%)
C2H2 Zn finger 411..431 CDD:275368 8/48 (17%)
C2H2 Zn finger 439..459 CDD:275368 10/20 (50%)
C2H2 Zn finger 467..487 CDD:275368 8/20 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24377
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.