DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5245 and ZNF324B

DIOPT Version :8

Sequence 1:NP_650197.1 Gene:CG5245 / 41530 FlyBaseID:FBgn0038047 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_997278.2 Gene:ZNF324B / 388569 HGNCID:33107 Length:544 Species:Homo sapiens

Alignment Length:439 Identity:147/440 (33%)
Similarity:202/440 (46%) Gaps:69/440 (16%)


  Fly     8 QRPVKDEPPQED-------TFEEELIFISNSDFEELESEIKIENFCSYGKDLEPVKGVPSKLKTC 65
            ||.....|.||.       .:.|.|:..|.||    ::.|.:.              :.|.|:..
Human   123 QRQPGASPSQERKPTGVSVIYWERLLLGSRSD----QASISLR--------------LTSPLRPP 169

  Fly    66 KSKIAKKRPLRKQTDTFKCTQCQKTFT------RKENLESHLRLHAEERPFECSHCSKSFGRRTH 124
            ||    .||.            :||||      |:.......:..|:|.|      .::||..:.
Human   170 KS----SRPR------------EKTFTEYRVPGRQPRTPERQKPCAQEVP------GRAFGNASD 212

  Fly   125 YK-------RHLLKHEKRPHKCSHCSKTFTQNSSLKQHLHE--HTGERPFKCTQCSTSFARKSHL 180
            .|       |.:....:.||:.     ...|..|....|.|  |.||:.|:|..||..|.:.|.|
Human   213 LKAASGGRDRRMGAAWQEPHRL-----LGGQEPSTWDELGEALHAGEKSFECRACSKVFVKSSDL 272

  Fly   181 QVHLRTHSEERPFECTHCEKAFKNNSHLQEHLRTHQEARPFKCSHCSKSFKLRSILQKHLLTH-A 244
            ..|||||:.|||:|||.|.|||...|||.:|.|.|....|:.|..|.|:|:..|.|.:|...| |
Human   273 LKHLRTHTGERPYECTQCGKAFSQTSHLTQHQRIHSGETPYACPVCGKAFRHSSSLVRHQRIHTA 337

  Fly   245 ERSFKCTQCPKTFLQNDSLQIHLRVHAGEDPFKCPHCSETFARNSRLQLHLLEHAGKEPLKCSQC 309
            |:||:|::|.|.|....:|..|.::|||..|:.|..|...|.|||.|..|...|.|::|..|:.|
Human   338 EKSFRCSECGKAFSHGSNLSQHRKIHAGGRPYACAQCGRRFCRNSHLIQHERTHTGEKPFVCALC 402

  Fly   310 SATFAMRSLYRVHVRLHTRERQYKCAECSKSFFKKSHLVEHQQVHTGERPFKCTHCFKDFKCRTH 374
            .|.|:..|...:|.|:||.|:.:.||:|.:||.:.|:|.:||.:|||||||:|..|.|.|.....
Human   403 GAAFSQGSSLFLHQRVHTGEKPFACAQCGRSFSRSSNLTQHQLLHTGERPFRCVDCGKGFAKGAV 467

  Fly   375 LRVHMLDHIGEKVPKCSYCSKEFKLSSQLLVHLQEH-TGKNQFECPHCS 422
            |..|...|.|||...|:.|.:.|:....||.|.:.| |.|.....|.|:
Human   468 LLSHRRIHTGEKPFVCTQCGRAFRERPALLHHQRIHTTEKTNAAAPDCT 516

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5245NP_650197.1 COG5048 74..478 CDD:227381 131/367 (36%)
C2H2 Zn finger 84..104 CDD:275368 5/26 (19%)
C2H2 Zn finger 112..132 CDD:275368 4/27 (15%)
C2H2 Zn finger 139..159 CDD:275368 4/22 (18%)
C2H2 Zn finger 167..187 CDD:275368 10/20 (50%)
zf-H2C2_2 179..204 CDD:290200 16/25 (64%)
C2H2 Zn finger 195..215 CDD:275368 11/20 (55%)
C2H2 Zn finger 223..243 CDD:275368 7/20 (35%)
C2H2 Zn finger 250..270 CDD:275368 6/20 (30%)
C2H2 Zn finger 278..298 CDD:275368 8/20 (40%)
C2H2 Zn finger 306..326 CDD:275368 7/20 (35%)
C2H2 Zn finger 334..354 CDD:275368 9/20 (45%)
C2H2 Zn finger 362..382 CDD:275368 6/20 (30%)
C2H2 Zn finger 390..410 CDD:275368 6/20 (30%)
C2H2 Zn finger 418..438 CDD:275368 2/6 (33%)
C2H2 Zn finger 446..466 CDD:275368
C2H2 Zn finger 474..492 CDD:275368
ZNF324BNP_997278.2 KRAB 1..61 CDD:214630
C2H2 Zn finger 259..279 CDD:275368 10/20 (50%)
COG5048 <268..499 CDD:227381 98/231 (42%)
C2H2 Zn finger 287..307 CDD:275368 11/20 (55%)
C2H2 Zn finger 315..335 CDD:275368 7/20 (35%)
C2H2 Zn finger 343..363 CDD:275368 6/20 (30%)
C2H2 Zn finger 371..391 CDD:275368 8/20 (40%)
C2H2 Zn finger 399..419 CDD:275368 7/20 (35%)
C2H2 Zn finger 427..447 CDD:275368 9/20 (45%)
C2H2 Zn finger 455..475 CDD:275368 6/20 (30%)
C2H2 Zn finger 483..503 CDD:275368 6/20 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24377
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.