DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5245 and ZFP82

DIOPT Version :8

Sequence 1:NP_650197.1 Gene:CG5245 / 41530 FlyBaseID:FBgn0038047 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_001308846.1 Gene:ZFP82 / 284406 HGNCID:28682 Length:533 Species:Homo sapiens

Alignment Length:472 Identity:154/473 (33%)
Similarity:243/473 (51%) Gaps:39/473 (8%)


  Fly    15 PPQEDTFEEELIFISNSDFEELESEIKI-ENFCSYG-------KDLE----------PVKGVPSK 61
            |..|..:|.:.:.:.|..:|...|:.|| |...::|       .|.|          |.:|..|.
Human    77 PDLETKYETKKLSLENDIYEINLSQWKIMERIENHGLKGLILKNDWESTGKIEGQERPQEGYFSS 141

  Fly    62 LKTCKSKIAKKRPLRKQTDTFKCTQCQKTFTRKENLESHLRLHAEERPFECSHCSKSFGRRTHYK 126
            :|....|::                   ::.::.::..|.|||..::|:||..|.|:|..|....
Human   142 VKMPSEKVS-------------------SYQKRTSVTPHQRLHFVDKPYECKECGKAFRVRQQLT 187

  Fly   127 RHLLKHE-KRPHKCSHCSKTFTQNSSLKQHLHEHTGERPFKCTQCSTSFARKSHLQVHLRTHSEE 190
            .|...|. ::|::|..|...|.|.:.|.:|...|:||:.::|.:|..:|...:.|:||.:.|..|
Human   188 FHHRIHTGEKPYECKECGMAFRQTAHLTRHQRLHSGEKLYECKECGEAFICGADLRVHQKMHIGE 252

  Fly   191 RPFECTHCEKAFKNNSHLQEHLRTHQEARPFKCSHCSKSFKLRSILQKH-LLTHAERSFKCTQCP 254
            :|:||..|.|||:....|..|.|.|...:|:.|..|.|:|:..:.|.:| .|..|:|.::|.:|.
Human   253 KPYECKECGKAFRVRGQLTLHQRIHTGEKPYVCKECGKAFRQYAHLTRHQKLNSADRLYECKECG 317

  Fly   255 KTFLQNDSLQIHLRVHAGEDPFKCPHCSETFARNSRLQLHLLEHAGKEPLKCSQCSATFAMRSLY 319
            |.||....|::|.::|.||.|::|..|.:.|....:|.||...|.|::|.:|.:|..||:.....
Human   318 KAFLCGSGLRVHHKLHTGEKPYECKECGKAFRVRQQLTLHQRIHTGEKPYECKECGKTFSRGYHL 382

  Fly   320 RVHVRLHTRERQYKCAECSKSFFKKSHLVEHQQVHTGERPFKCTHCFKDFKCRTHLRVHMLDHIG 384
            .:|.|:||.|:.|:|.||.|:|.:.|.|:.||.:|.|.:|:.|..|.|.|:..:.|..|...|||
Human   383 ILHHRIHTGEKPYECKECWKAFSRYSQLISHQSIHIGVKPYDCKECGKAFRLLSQLTQHQSIHIG 447

  Fly   385 EKVPKCSYCSKEFKLSSQLLVHLQEHTGKNQFECPHCSKSYTTSSTLHMHLRTHTGELPFKCSHC 449
            ||..||..|.|.|:|..:|.:|...|||:..|||..|.|::..:|:|..|||.|:||.|::|..|
Human   448 EKPYKCKECGKAFRLRQKLTLHQSIHTGEKPFECKECRKAFRLNSSLIQHLRIHSGEKPYECKEC 512

  Fly   450 SKLFARSAEHQEHLRTH 466
            .|.|.:.:....||:.|
Human   513 KKAFRQHSHLTHHLKIH 529

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5245NP_650197.1 COG5048 74..478 CDD:227381 137/396 (35%)
C2H2 Zn finger 84..104 CDD:275368 3/20 (15%)
C2H2 Zn finger 112..132 CDD:275368 6/20 (30%)
C2H2 Zn finger 139..159 CDD:275368 6/20 (30%)
C2H2 Zn finger 167..187 CDD:275368 6/20 (30%)
zf-H2C2_2 179..204 CDD:290200 12/25 (48%)
C2H2 Zn finger 195..215 CDD:275368 8/20 (40%)
C2H2 Zn finger 223..243 CDD:275368 7/21 (33%)
C2H2 Zn finger 250..270 CDD:275368 7/20 (35%)
C2H2 Zn finger 278..298 CDD:275368 6/20 (30%)
C2H2 Zn finger 306..326 CDD:275368 6/20 (30%)
C2H2 Zn finger 334..354 CDD:275368 9/20 (45%)
C2H2 Zn finger 362..382 CDD:275368 6/20 (30%)
C2H2 Zn finger 390..410 CDD:275368 7/20 (35%)
C2H2 Zn finger 418..438 CDD:275368 8/20 (40%)
C2H2 Zn finger 446..466 CDD:275368 6/20 (30%)
C2H2 Zn finger 474..492 CDD:275368
ZFP82NP_001308846.1 KRAB 6..66 CDD:214630
COG5048 144..527 CDD:227381 137/402 (34%)
C2H2 Zn finger 173..193 CDD:275368 6/20 (30%)
C2H2 Zn finger 201..221 CDD:275368 6/20 (30%)
C2H2 Zn finger 229..249 CDD:275368 6/20 (30%)
C2H2 Zn finger 257..277 CDD:275368 8/20 (40%)
C2H2 Zn finger 285..304 CDD:275368 6/19 (32%)
C2H2 Zn finger 313..333 CDD:275368 7/20 (35%)
C2H2 Zn finger 341..361 CDD:275368 6/20 (30%)
C2H2 Zn finger 369..389 CDD:275368 6/20 (30%)
C2H2 Zn finger 397..417 CDD:275368 9/20 (45%)
C2H2 Zn finger 425..445 CDD:275368 6/20 (30%)
C2H2 Zn finger 453..473 CDD:275368 7/20 (35%)
C2H2 Zn finger 481..501 CDD:275368 8/20 (40%)
C2H2 Zn finger 509..529 CDD:275368 6/20 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24377
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.