DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5245 and ZNF595

DIOPT Version :8

Sequence 1:NP_650197.1 Gene:CG5245 / 41530 FlyBaseID:FBgn0038047 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_872330.1 Gene:ZNF595 / 152687 HGNCID:27196 Length:648 Species:Homo sapiens

Alignment Length:572 Identity:183/573 (32%)
Similarity:276/573 (48%) Gaps:102/573 (18%)


  Fly    14 EPPQEDTFEEELI-----------FISNSD----FEEL---------ESEIKIENFCS-YGKDLE 53
            :|.|::.:.:.::           .|||.|    .|::         |:..|....|| :.:||.
Human    22 DPAQQNLYRDVMLENYRNLVSLGFVISNPDLVTCLEQIKEPCNLKIHETAAKPPAICSPFSQDLS 86

  Fly    54 PVKGVPSKLKTCKSKIAKKR---------PLRK-------------------------QTDTFKC 84
            ||:|:....    .|:..||         .|||                         |:..|:|
Human    87 PVQGIEDSF----HKLILKRYEKCGHENLQLRKGCKRVNECKVQKGVNNGVYQCLSTTQSKIFQC 147

  Fly    85 TQCQKTFTRKENLESHLRLHAEERPFECSHCSKSFGRRTHYKRHLLKHE-----KRPHKCSHCSK 144
            ..|.|.|::..|...|...|..|:||:|:.|.:||     |..||.:|.     ::|:||..|.|
Human   148 NTCVKVFSKFSNSNKHKIRHTGEKPFKCTECGRSF-----YMSHLTQHTGIHAGEKPYKCEKCGK 207

  Fly   145 TFTQNSSLKQHLHEHTGERPFKCTQCSTSFARKSHLQVHLRTHSEERPFECTHCEKAFKNNSHLQ 209
            .|.:::||.:|...||||:|:.|.:|..:|.|.:.|..|.:.|:.|:|::|..|.|||..::.|.
Human   208 AFNRSTSLSKHKRIHTGEKPYTCEECGKAFRRSTVLNEHKKIHTGEKPYKCEECGKAFTRSTTLN 272

  Fly   210 EHLRTHQEARPFKCSHCSKSFKLRSILQKHLLTH-AERSFKCTQCPKTFLQNDSLQIHLRVHAGE 273
            ||.:.|...:|:||..|.|:|:..:.|.:|...| .|:.:||.:|.|.|.|:.||..|..:|.||
Human   273 EHKKIHTGEKPYKCKECGKAFRWSTSLNEHKNIHTGEKPYKCKECGKAFRQSRSLNEHKNIHTGE 337

  Fly   274 DPFKCPHCSETFARNSRLQLHLLEHAGKEPLKCSQCSATFAMRSLYRVHVRLHTRERQYKCAECS 338
            .|:.|..|.:.|.::|.|.:|...|:.::..||.:|...|...|....|.|:||.|:.|.|.||.
Human   338 KPYTCEKCGKAFNQSSSLIIHRSIHSEQKLYKCEECGKAFTWSSSLNKHKRIHTGEKPYTCEECG 402

  Fly   339 KSFFKKSHLVEHQQVHTGERPFKCTHCFKDFKCRTHLRVHMLDHIGEKVPKCSYCSKEFKLSSQL 403
            |:|::.|||.:|:::||||:|:.|..|.|.|...:.|.:|...|.|:|..||..|.|.|..|:.|
Human   403 KAFYRSSHLAKHKRIHTGEKPYTCEECGKAFNQSSTLILHKRIHSGQKPYKCEECGKAFTRSTTL 467

  Fly   404 LVHLQEHTGKNQFECPHCSKSYTTSSTLHMHLRTHTGELP------------------------- 443
            ..|.:.|||:..::|..|.|::..|::|:.|...||||.|                         
Human   468 NEHKKIHTGEKPYKCEECGKAFIWSASLNEHKNIHTGEKPYKCKECGKAFNQSSGLIIHRSIHSE 532

  Fly   444 ---FKCSHCSKLFARSAEHQEHLRTHTGEKPYKCSHCSTRYTQKSSLGRHLR 492
               :||..|.|.|.||....||.:.|:|||||||..|...|...|:|.:|.|
Human   533 QKLYKCEECGKAFTRSTALNEHKKIHSGEKPYKCKECGKAYNLSSTLTKHKR 584

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5245NP_650197.1 COG5048 74..478 CDD:227381 159/463 (34%)
C2H2 Zn finger 84..104 CDD:275368 6/20 (30%)
C2H2 Zn finger 112..132 CDD:275368 7/20 (35%)
C2H2 Zn finger 139..159 CDD:275368 7/20 (35%)
C2H2 Zn finger 167..187 CDD:275368 6/20 (30%)
zf-H2C2_2 179..204 CDD:290200 10/25 (40%)
C2H2 Zn finger 195..215 CDD:275368 8/20 (40%)
C2H2 Zn finger 223..243 CDD:275368 6/20 (30%)
C2H2 Zn finger 250..270 CDD:275368 8/20 (40%)
C2H2 Zn finger 278..298 CDD:275368 6/20 (30%)
C2H2 Zn finger 306..326 CDD:275368 6/20 (30%)
C2H2 Zn finger 334..354 CDD:275368 9/20 (45%)
C2H2 Zn finger 362..382 CDD:275368 6/20 (30%)
C2H2 Zn finger 390..410 CDD:275368 7/20 (35%)
C2H2 Zn finger 418..438 CDD:275368 6/20 (30%)
C2H2 Zn finger 446..466 CDD:275368 8/20 (40%)
C2H2 Zn finger 474..492 CDD:275368 6/18 (33%)
ZNF595NP_872330.1 KRAB 4..64 CDD:214630 7/42 (17%)
C2H2 Zn finger 147..167 CDD:275368 6/20 (30%)
C2H2 Zn finger 175..194 CDD:275368 8/24 (33%)
COG5048 198..599 CDD:227381 141/388 (36%)
C2H2 Zn finger 202..222 CDD:275368 7/20 (35%)
C2H2 Zn finger 230..250 CDD:275368 6/20 (30%)
C2H2 Zn finger 258..278 CDD:275368 8/20 (40%)
C2H2 Zn finger 286..306 CDD:275368 6/20 (30%)
C2H2 Zn finger 314..334 CDD:275368 8/20 (40%)
C2H2 Zn finger 342..362 CDD:275368 6/20 (30%)
C2H2 Zn finger 370..390 CDD:275368 6/20 (30%)
C2H2 Zn finger 398..418 CDD:275368 9/20 (45%)
C2H2 Zn finger 426..446 CDD:275368 6/20 (30%)
C2H2 Zn finger 454..474 CDD:275368 7/20 (35%)
C2H2 Zn finger 482..502 CDD:275368 6/20 (30%)
C2H2 Zn finger 510..530 CDD:275368 0/20 (0%)
C2H2 Zn finger 538..558 CDD:275368 8/20 (40%)
C2H2 Zn finger 566..586 CDD:275368 7/20 (35%)
C2H2 Zn finger 594..614 CDD:275368
C2H2 Zn finger 622..642 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24377
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.