DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sccpdh2 and SCCPDH

DIOPT Version :8

Sequence 1:NP_650190.1 Gene:Sccpdh2 / 41521 FlyBaseID:FBgn0038038 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_057086.2 Gene:SCCPDH / 51097 HGNCID:24275 Length:429 Species:Homo sapiens

Alignment Length:433 Identity:166/434 (38%)
Similarity:259/434 (60%) Gaps:28/434 (6%)


  Fly     9 IIFGASGFTGKYTVFEAV------SVLKGLQWGIAGRNQEKLQSVLREMGAK--SKTDLSQTPIV 65
            ::||||||||::...|..      .....|.|.:|||::||||.||.:...|  ..|..|:..|:
Human    11 VVFGASGFTGQFVTEEVAREQVDPERSSRLPWAVAGRSREKLQRVLEKAALKLGRPTLSSEVGII 75

  Fly    66 IADVNNEASLLEMAKRCRILVNTAGPYRFFGERVVRACIEAGTHHVDVSGEPQYMETMQLRYHDL 130
            |.|:.|.|||.||||:..:::|..|||||:||.|::||||.|...:|:|||||::|.|||:||:.
Human    76 ICDIANPASLDEMAKQATVVLNCVGPYRFYGEPVIKACIENGASCIDISGEPQFLELMQLKYHEK 140

  Fly   131 AKERGVYVISACGFDSIPADMGVTFVEKNFDGVVNSVENF--VHLGVKGGTKGTGSAALNTGTWE 193
            |.::|||:|.:.||||||||:||.:.....:|.:.:||:|  :|.|.:|       .:::.|||:
Human   141 AADKGVYIIGSSGFDSIPADLGVIYTRNKMNGTLTAVESFLTIHSGPEG-------LSIHDGTWK 198

  Fly   194 SAIHAIANRSESVAIRRKLFPERLPNFHPALKSRSPLSRAAEVDNKVILPFPETDRSVVMRSQRF 258
            |||:...::|....:|.....:.:|...|.||.|.|:|...|:....| ||..:|.|||.|:||:
Human   199 SAIYGFGDQSNLRKLRNVSNLKPVPLIGPKLKRRWPISYCRELKGYSI-PFMGSDVSVVRRTQRY 262

  Fly   259 LYELEKKRPVQMQAYMTYPSWFAASVVVLFASIIGI-MAKFSFGRQLLLKYPTVFSGGMASREGP 322
            |||..::.|||..||:|. ....:.:.::||.:..: ..:|..|||||:|:|..||.|..|::||
Human   263 LYENLEESPVQYAAYVTV-GGITSVIKLMFAGLFFLFFVRFGIGRQLLIKFPWFFSFGYFSKQGP 326

  Fly   323 SEARMERSFFRMTMKATGWPKSEKLAETTDQYTSPPTKTLTVRVTGPNPGYGSTCVALLSTAKTI 387
            ::.:::.:.|.:|....|:      ::.|....:.|...:..:|.||..||.:|.:|::..|.|:
Human   327 TQKQIDAASFTLTFFGQGY------SQGTGTDKNKPNIKICTQVKGPEAGYVATPIAMVQAAMTL 385

  Fly   388 LNESDKMPGSGGVLPPGAAFRGTSLISELEKHEHGIKFEIVAN 430
            |:::..:|.:|||..|||||..|.||..|.|  |||:|.::::
Human   386 LSDASHLPKAGGVFTPGAAFSKTKLIDRLNK--HGIEFSVISS 426

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Sccpdh2NP_650190.1 COG3268 7..416 CDD:225807 160/418 (38%)
Sacchrp_dh_NADP 9..139 CDD:281434 64/138 (46%)
SCCPDHNP_057086.2 COG3268 1..421 CDD:225807 165/427 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C141702025
eggNOG 1 0.900 E1_COG3268
Hieranoid 1 1.000
Homologene 1 1.000 H9334
Inparanoid 1 1.050 300 1.000 Inparanoid score I2659
Isobase 1 0.950 0 Normalized mean entropy S4069
OMA 1 1.010
OrthoDB 1 1.010 D302978at33208
OrthoFinder 1 1.000 FOG0002132
OrthoInspector 1 1.000 T609752
orthoMCL 1 0.900 OOG5_128445
Panther 1 1.100 O PTHR12286
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4081
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1514.750

Return to query results.
Submit another query.