DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sccpdh2 and sccpdha.1

DIOPT Version :8

Sequence 1:NP_650190.1 Gene:Sccpdh2 / 41521 FlyBaseID:FBgn0038038 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_001002359.1 Gene:sccpdha.1 / 436632 ZFINID:ZDB-GENE-040718-51 Length:427 Species:Danio rerio

Alignment Length:442 Identity:177/443 (40%)
Similarity:256/443 (58%) Gaps:51/443 (12%)


  Fly     9 IIFGASGFTGKYTVFE----AVSVLKG-LQWGIAGRNQEKLQSVLREMGAK-SKTDL-SQTPIVI 66
            ||||||||||::.|.|    |....|| |:|.:|||::.||:.|:.:..|. .|.:| ::..|::
Zfish    15 IIFGASGFTGQFVVEEVSRCASEGPKGSLKWAVAGRSKPKLEKVIEQAAANLGKPELKTEVDIIV 79

  Fly    67 ADVNNEASLLEMAKRCRILVNTAGPYRFFGERVVRACIEAGTHHVDVSGEPQYMETMQLRYHDLA 131
            |||:::.||..|.|:..|:::..||||||||.||::|:|.|.|.:|:|||||::|.|||.|||.|
Zfish    80 ADVSDQESLAAMCKQAVIVLSCVGPYRFFGEPVVKSCVENGAHCLDISGEPQFLEGMQLNYHDQA 144

  Fly   132 KERGVYVISACGFDSIPADMGVTFVEKNFDGVVNSVENFVHLGVKGGTKGTGSAALNTGTWESAI 196
            .::|||::.:||||||||||||.:....|.|.:.:|::|:.||     .|...:.||.|||:|.|
Zfish   145 ADKGVYIVGSCGFDSIPADMGVIYTRDQFKGTLTAVDSFLTLG-----SGPEGSCLNDGTWQSVI 204

  Fly   197 HAIANRSESVAIRRKLFPERLPNFHPALKSRSPLSRAAEVDNKVILPFPETDRSVVMRSQRFLYE 261
            :.:|::.:..::|:|...:.||...|.:|.|..|..::||....| ||..||.|||.|:||:|:|
Zfish   205 YGLADKGKLKSLRKKFGHKPLPVVGPKIKRRGLLFYSSEVQQYAI-PFIGTDPSVVKRTQRYLHE 268

  Fly   262 LEKKRPVQMQAYMTYPSWFAASVVVLFASIIGIMAKFSF---------------GRQLLLKYPTV 311
            ...:.|||..||               |.|.||...|.|               ||:||:|||..
Zfish   269 ELNETPVQYGAY---------------AGIGGISNVFKFLISGFMFCLLALCSCGRKLLIKYPEF 318

  Fly   312 FSGGMASREGPSEARMERSFFRMTMKATGWPKSEKLAETTDQYTSPPTKTLTVRVTGPNPGYGST 376
            ||.|..|.|||::.::|.:.|.:.....|:.|.:      |.....|...:...|.||..||.:|
Zfish   319 FSFGFFSTEGPTKKQIEDASFHILFFGDGYTKGQ------DPSKGKPNGKIRTEVKGPEAGYVTT 377

  Fly   377 CVALLSTAKTILNESDKMPGSGGVLPPGAAFRGTSLISELEKHEHGIKFEIV 428
            .:|::..|.|:|||.|.:|.:|||..|||.|..|:||..|.|  |||:|.::
Zfish   378 PIAMVQAAITMLNEPDSLPQTGGVYTPGATFAKTTLIKRLNK--HGIEFSVI 427

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Sccpdh2NP_650190.1 COG3268 7..416 CDD:225807 171/429 (40%)
Sacchrp_dh_NADP 9..139 CDD:281434 66/137 (48%)
sccpdha.1NP_001002359.1 COG3268 10..424 CDD:225807 176/438 (40%)
Sacchrp_dh_NADP 14..152 CDD:281434 66/137 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C141704997
eggNOG 1 0.900 E1_COG3268
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H9334
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D302978at33208
OrthoFinder 1 1.000 FOG0002132
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_128445
Panther 1 1.100 O PTHR12286
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4081
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1110.750

Return to query results.
Submit another query.