DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DNAlig3 and DNL4

Sequence 1:NP_650187.2 Gene:DNAlig3 FlyBaseID:FBgn0286075 Length:806 Species:Drosophila melanogaster
Sequence 2:NP_014647.1 Gene:DNL4 SGDID:S000005531 Length:944 Species:Saccharomyces cerevisiae

Alignment Length:914 Identity:191/915 (21%)
Similarity:323/915 (35%) Gaps:325/915 (36%)


  Fly    36 FRRICDEI--------------AGESSYLKKAERLQRFFE--KGSSGKGFKGDTVLWVQFLIPAA 84
            |:.:|:|:              .|:|...|..|.:..|.|  :.:.|.......||    .:|..
Yeast    20 FKWLCEELFVKIHEVQINGTAGTGKSRSFKYYEIISNFVEMWRKTVGNNIYPALVL----ALPYR 80

  Fly    85 NQRVYNLQNKALIKLFSRIF----NADQQQMHLDLEQ----DGDVSETLRK-------------- 127
            ::|:||:::..||:......    |:..:|...|.:|    .|::|..|.:              
Yeast    81 DRRIYNIKDYVLIRTICSYLKLPKNSATEQRLKDWKQRVGKGGNLSSLLVEEIAKRRAEPSSKAI 145

  Fly   128 ---------------HFAASKKLKPQKQSKLYLQEVEEMLLHLVERTKEDEQTDLLQKLCSKATD 177
                           .||:.:..|...:||.:|..||.|                        :.
Yeast   146 TIDNVNHYLDSLSGDRFASGRGFKSLVKSKPFLHCVENM------------------------SF 186

  Fly   178 LDLRTFIRLVKHDLRINARARHILDAFGPDAYPAYQSSRDLVAIVEQFATKENKNYASSPVKKTK 242
            ::|:.|..:|..:..|..:...:|:.:.|||       :|.::::.......:|.|  .| |...
Yeast   187 VELKYFFDIVLKNRVIGGQEHKLLNCWHPDA-------QDYLSVISDLKVVTSKLY--DP-KVRL 241

  Fly   243 KTSSSAIQVMTPISPMLASP--------CKSVEDAFKKSPTGLYSEIKYDGERVQIH--KQGNDF 297
            |....:|:|....:|.||..        |:::.|.|       ..|.|.||||:|:|  ..|...
Yeast   242 KDDDLSIKVGFAFAPQLAKKVNLSYEKICRTLHDDF-------LVEEKMDGERIQVHYMNYGESI 299

  Fly   298 KFFSRNLKPVVDHKIRALKKYIPQAFPGGG-------------EMILDSEIILVDTDTGALLPFG 349
            |||||.   .:|:      .|:..|....|             |.:||.|::..|.....:||||
Yeast   300 KFFSRR---GIDY------TYLYGASLSSGTISQHLRFTDSVKECVLDGEMVTFDAKRRVILPFG 355

  Fly   350 SLGAHKKQTFANAAV-------CLFVFDCILYDGEDLTQLPFRKRREILEQNIQPIKSHVQLSES 407
            .:....|:..:..::       ...|||.:..:|..||.||..:|::.|...:.|:|:.|::..|
Yeast   356 LVKGSAKEALSFNSINNVDFHPLYMVFDLLYLNGTSLTPLPLHQRKQYLNSILSPLKNIVEIVRS 420

  Fly   408 ------EFLKTTRELAAMTARVLHANLEGVVLKSPTSTYQPGKR--NWLKVKKDYLFDGKMADTA 464
                  |.:|.:.|:|      :....||||||...|:|....|  ||:|||.:||  .:..:..
Yeast   421 SRCYGVESIKKSLEVA------ISLGSEGVVLKYYNSSYNVASRNNNWIKVKPEYL--EEFGENL 477

  Fly   465 DLVVLGAWYGSGKKGGTLSIFLMGCYDAFGRLWKTVTKVHSG----LDDATNAEVH--------- 516
            ||:|:|.  .||||..    |::|..    .|.:...|.|.|    :.|.::.|.|         
Yeast   478 DLIVIGR--DSGKKDS----FMLGLL----VLDEEEYKKHQGDSSEIVDHSSQEKHIQNSRRRVK 532

  Fly   517 -----------------KSLIKLT----ERADANAIPSWLLCSKSLVPDVLAK--DPMKMPVWEI 558
                             |.:.:.|    :|....|.|:.:|...|.:|   |:  ||.:..|.||
Yeast   533 KILSFCSIANGISQEEFKEIDRKTRGHWKRTSEVAPPASILEFGSKIP---AEWIDPSESIVLEI 594

  Fly   559 TGAEFTKSDAHT---ASGISVRFPRITRRRSDKSAKEANDLAHLEDLFEASKSNVNVDLLLANCS 620
            .......::.:.   |:..::......|.|.|   ||..|...|.||:|                
Yeast   595 KSRSLDNTETNMQKYATNCTLYGGYCKRIRYD---KEWTDCYTLNDLYE---------------- 640

  Fly   621 KDETAMNNKTTPEKEKKLNGNQSNGSKKLKRSNTGSDDEDGAPVLSKRKESKAIRSLSPSQKGLK 685
                   ::|.          :||.|.:.:||..|         |.::|..:.:         :.
Yeast   641 -------SRTV----------KSNPSYQAERSQLG---------LIRKKRKRVL---------IS 670

  Fly   686 DFFKPSKEFKSVVKKEPKEDEGNIESTSSKPQLFEGLVAHFAME---KDS------SKLMQQFSQ 741
            |.|..::      |:.|..:            :|.||:.:...:   :|:      ::|.:...:
Yeast   671 DSFHQNR------KQLPISN------------IFAGLLFYVLSDYVTEDTGIRITRAELEKTIVE 717

  Fly   742 HGG--------------------CCTTEPQKADLVFYANTNEALDLEKLRTLYRRSCRHLNVSWL 786
            |||                    |.||...||                   |..|....|:.:|:
Yeast   718 HGGKLIYNVILKRHSIGDVRLISCKTTTECKA-------------------LIDRGYDILHPNWV 763

  Fly   787 QSCL 790
            ..|:
Yeast   764 LDCI 767

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DNAlig3NP_650187.2 DNA_ligase_A_N 36..200 CDD:282522 38/217 (18%)
dnl1 88..604 CDD:273147 145/630 (23%)
Adenylation_DNA_ligase_III 242..454 CDD:185712 69/250 (28%)
OBF_DNA_ligase_III 460..598 CDD:153436 38/177 (21%)
DNL4NP_014647.1 DNA_ligase_A_N 20..207 CDD:282522 38/215 (18%)
dnl1 84..717 CDD:273147 164/776 (21%)
Adenylation_DNA_ligase_IV 244..471 CDD:185713 70/251 (28%)
OBF_DNA_ligase_IV 474..635 CDD:153437 38/177 (21%)
BRCT 681..767 CDD:278934 19/117 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1793
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.