DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DNAlig3 and CDC9

Sequence 1:NP_650187.2 Gene:DNAlig3 FlyBaseID:FBgn0286075 Length:806 Species:Drosophila melanogaster
Sequence 2:NP_010117.1 Gene:CDC9 SGDID:S000002323 Length:755 Species:Saccharomyces cerevisiae

Alignment Length:622 Identity:169/623 (27%)
Similarity:271/623 (43%) Gaps:74/623 (12%)


  Fly    36 FRRICD---EIAGESSYLKKAERLQRFFEK--GSSGKGFKGDTVLWVQFLIPAANQRV-YNLQNK 94
            :..:|:   :|...||.|:.......||.|  ..|.|.....|.|::..|.|.....: ..|...
Yeast   148 YSEVCEVFNKIEAISSRLEIIRICSDFFIKIMKQSSKNLIPTTYLFINRLGPDYEAGLELGLGEN 212

  Fly    95 ALIKLFSRIFNADQQQMHLDLEQDGDVSETLRKHFAASKKLKPQ--KQSKLYLQEVEEMLLHLVE 157
            .|:|..|........|:.|..:..||:.|..    ..::.::|.  |...|.:.||.:.|..:.:
Yeast   213 LLMKTISETCGKSMSQIKLKYKDIGDLGEIA----MGARNVQPTMFKPKPLTVGEVFKNLRAIAK 273

  Fly   158 RTKEDEQ---TDLLQKLCSKATDLDLRTFIRLVKHDLRINARARHILDAF-------------GP 206
            ...:|.|   ..|::::.:....::.:..||.::..|||....:.:|.:.             .|
Yeast   274 TQGKDSQLKKMKLIKRMLTACKGIEAKFLIRSLESKLRIGLAEKTVLISLSKALLLHDENREDSP 338

  Fly   207 D-------AYPAYQSSRDLVAIVEQFATKENKNYASSPVKKTKKTSSSAIQVMTPISPMLASPCK 264
            |       ...|.|..||....|..:....|.......:...|..:   ::...|:.||||.|.|
Yeast   339 DKDVPMDVLESAQQKIRDAFCQVPNYEIVINSCLEHGIMNLDKYCT---LRPGIPLKPMLAKPTK 400

  Fly   265 SVEDAFKKSPTGLY-SEIKYDGERVQIHKQGND--FKFFSRNLKPVVDH--KIRALKKYIPQAFP 324
            ::.:...:.....: ||.||||||.|:|.. ||  .:.:|||.:.:.:.  :|. :..:| |...
Yeast   401 AINEVLDRFQGETFTSEYKYDGERAQVHLL-NDGTMRIYSRNGENMTERYPEIN-ITDFI-QDLD 462

  Fly   325 GGGEMILDSEIILVDTDTGALLPFGSLGAHKKQTF----ANAAVCLFVFDCILYDGEDLTQLPFR 385
            ....:|||.|.:..|.|.|.:|||..|...|::..    ....||||.||.:.|:.|.|.....:
Yeast   463 TTKNLILDCEAVAWDKDQGKILPFQVLSTRKRKDVELNDVKVKVCLFAFDILCYNDERLINKSLK 527

  Fly   386 KRREILEQNIQPIKSHVQLSESEFLKTTRELAAMTARVLHANLEGVVLK---SPTSTYQPGK--R 445
            :|||.|.:..:.:....|.:.........||.......::.:.||:::|   .|.|.|:|.|  |
Yeast   528 ERREYLTKVTKVVPGEFQYATQITTNNLDELQKFLDESVNHSCEGLMVKMLEGPESHYEPSKRSR 592

  Fly   446 NWLKVKKDYLFDGKMADTADLVVLGAWYGSGKKGGTLSIFLMGCYDAFGRLWKTVTKVHSGLDDA 510
            ||||:||||| :| :.|:.||.||||:||.||:.||...||:|||:.....::|..|:.:|..|.
Yeast   593 NWLKLKKDYL-EG-VGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNQDTGEFETCCKIGTGFSDE 655

  Fly   511 TNAEVHKSLI-------KLTERADANAIPS-WLLCSKSLVPDVLAKDPMKMPVWEITGAEFTKSD 567
            ....:|..|.       |.|...|::|.|. |.  ..:.:.:||..|....|:::...|.|.|  
Yeast   656 MLQLLHDRLTPTIIDGPKATFVFDSSAEPDVWF--EPTTLFEVLTADLSLSPIYKAGSATFDK-- 716

  Fly   568 AHTASGISVRFPRITRRRSDKSAKEANDLAHLEDLFE 604
                 |:|:||||..|.|.||..::|.....:.:|:|
Yeast   717 -----GVSLRFPRFLRIREDKGVEDATSSDQIVELYE 748

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DNAlig3NP_650187.2 DNA_ligase_A_N 36..200 CDD:282522 37/175 (21%)
dnl1 88..604 CDD:273147 154/564 (27%)
Adenylation_DNA_ligase_III 242..454 CDD:185712 70/226 (31%)
OBF_DNA_ligase_III 460..598 CDD:153436 48/146 (33%)
CDC9NP_010117.1 dnl1 215..748 CDD:273147 152/554 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1793
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.