DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DNAlig3 and LIG6

Sequence 1:NP_650187.2 Gene:DNAlig3 FlyBaseID:FBgn0286075 Length:806 Species:Drosophila melanogaster
Sequence 2:NP_176845.2 Gene:LIG6 AraportID:AT1G66730 Length:1396 Species:Arabidopsis thaliana

Alignment Length:674 Identity:176/675 (26%)
Similarity:278/675 (41%) Gaps:168/675 (25%)


  Fly    56 LQRFFEKGSSGKG-----------FKGDTVLWVQFLIPAANQRVYNLQNK--------------- 94
            |.|.|....|.||           |:....|..:.::||    ||...||               
plant   770 LVRTFASVESEKGKIKAMSMLCNMFRSLFALSPEDVLPA----VYLCTNKIAADHENIELNIGGS 830

  Fly    95 ---ALIKLFSRIFNADQQQMHLDLEQDGDVSETLRKHFAASKKLKPQKQSKLYLQEVEEMLLHLV 156
               :.::....|..:..:.|:..|...|||::..|:   ..|.|.|  ...|.:::|...|..:.
plant   831 LISSALEEACGISRSTVRDMYNSLGDLGDVAQLCRQ---TQKLLVP--PPPLLVRDVFSTLRKIS 890

  Fly   157 ERTKEDE---QTDLLQKLCSKATDLDLRTFIRLVKHDLRINARARHILDAFGPDAYPAYQSSRDL 218
            .:|....   :.:|:.||.....:.:::..:|.:..:|||.|..|.:|.|.|            .
plant   891 VQTGTGSTRLKKNLIVKLMRSCREKEIKFLVRTLARNLRIGAMLRTVLPALG------------R 943

  Fly   219 VAIVEQFATKENKNYASSPVKKTKKTSSSA----------------------IQVMT-------- 253
            ..::..|....||..:.|..::..:..|:|                      |:..|        
plant   944 AIVMNSFWNDHNKELSESCFREKLEGVSAAVVEAYNILPSLDVVVPSLMDKDIEFSTSTLSMVPG 1008

  Fly   254 -PISPMLASPCKSVEDAFKKSPTGLYS-EIKYDGERVQIHK-QGNDFKFFSRN-------LKPVV 308
             ||.||||...|.|::.|..|....:: |.||||:|.|||| .......||||       ...:|
plant  1009 IPIKPMLAKIAKGVQEFFNLSQEKAFTCEYKYDGQRAQIHKLLDGTVCIFSRNGDETTSRFPDLV 1073

  Fly   309 DHKIRALKKYIPQAFPGGGEMILDSEIILVDTDTG-ALLPFGSLGAHKKQT--------FANAAV 364
            |    .:|::   :.|.....:||:|::..|...| .|:.|..|...::.:        .....|
plant  1074 D----VIKQF---SCPAAETFMLDAEVVATDRINGNKLMSFQELSTRERGSKDALITTESIKVEV 1131

  Fly   365 CLFVFDCILYDGEDLTQLPFRKRREILEQ--------NIQPIKSHVQLSESEFLK---TTRELAA 418
            |:||||.:..:||.|..||.|:||..|::        .::..|.....:|...|.   |...:.|
plant  1132 CVFVFDIMFVNGEQLLALPLRERRRRLKEVFPETRPGYLEYAKEITVGAEEASLNNHDTLSRINA 1196

  Fly   419 MTARVLHANLEGVVLKS--PTSTYQPGKR--NWLKVKKDYLFDGKMADTADLVVLGAWYGSGKKG 479
            .......::.||:::||  ..:.|.|.||  :|||||:||: || :.||.|||.:|||||:|:|.
plant  1197 FLEEAFQSSCEGIMVKSLDVNAGYCPTKRSDSWLKVKRDYV-DG-LGDTLDLVPIGAWYGNGRKA 1259

  Fly   480 GTLSIFLMGCYDAFGRLWKTVTKVHSGLDDATNAEVHKSLIKLTERADANAIPSWLLCSKSLVPD 544
            |..|.|||.|::.....:::|.:|.||..||...|:.:...:                     ..
plant  1260 GWYSPFLMACFNPETEEFQSVCRVMSGFSDAFYIEMKEFYSE---------------------DK 1303

  Fly   545 VLAKDPM-----KMP--------VWEITGAEFTKSDAHTAS--------GISVRFPRITRRRSDK 588
            :|||.|.     :.|        ||||.||:||.|..|:||        ||||||||...:.:|:
plant  1304 ILAKKPPYYRTGETPDMWFSAEVVWEIRGADFTVSPVHSASLGLVHPSRGISVRFPRFISKVTDR 1368

  Fly   589 SAKEANDLAHLEDLFEASKSNVNV 612
            :.:|.:....:.::|.|....:|:
plant  1369 NPEECSTATDIAEMFHAQTRKMNI 1392

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DNAlig3NP_650187.2 DNA_ligase_A_N 36..200 CDD:282522 37/176 (21%)
dnl1 88..604 CDD:273147 164/622 (26%)
Adenylation_DNA_ligase_III 242..454 CDD:185712 74/276 (27%)
OBF_DNA_ligase_III 460..598 CDD:153436 52/159 (33%)
LIG6NP_176845.2 SNM1A-1C-like_MBL-fold 42..204 CDD:293831
DRMBL 276..380 CDD:284854
PRK01109 766..1389 CDD:234900 175/670 (26%)
DNA_ligase_A_N 766..937 CDD:282522 37/176 (21%)
Adenylation_DNA_ligase_I_Euk 1002..1236 CDD:185710 70/241 (29%)
OBF_DNA_ligase_I 1241..1385 CDD:153438 53/165 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D274264at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.