DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DNAlig3 and AT1G49250

Sequence 1:NP_650187.2 Gene:DNAlig3 FlyBaseID:FBgn0286075 Length:806 Species:Drosophila melanogaster
Sequence 2:NP_175351.1 Gene:AT1G49250 AraportID:AT1G49250 Length:657 Species:Arabidopsis thaliana

Alignment Length:674 Identity:167/675 (25%)
Similarity:282/675 (42%) Gaps:143/675 (21%)


  Fly     1 MLLSRLTWQARI-LTRLLCNKMASKGLHNEDNKLDTFRRICDEIAGESSYLKKAERLQRFFEKGS 64
            :|..:.|...|| :|.:|||.:.:......|:.|.|.....:|||.....:|.           .
plant    51 LLKKKPTESGRIVITHILCNMLRTVIATTPDDLLPTVYLAANEIAPAHEGIKL-----------G 104

  Fly    65 SGKGFKGDTVLWVQFLIPAANQRVYNLQNKALIKLFSRIFNADQQQMHLDLEQDGDVSETLRKHF 129
            .|||                         ..:||..|..|...:..:.....|.||:.  |..:.
plant   105 MGKG-------------------------SYIIKAISEAFGRTESHVEQQYTQLGDLG--LVANG 142

  Fly   130 AASKKLKPQKQSKLYLQEVEEMLLHLVERT---KEDEQTDLLQKLCSKATDLDLRTFIRLVKHDL 191
            :.|.:........|.:.:|.:.|..:.:.:   .:|::.||::.|....||.:.....||::.:|
plant   143 SRSSQTMIFMPKPLTVVKVADTLRLIAKESGKGSKDKKKDLMKALLVATTDCEPLYLTRLLQDNL 207

  Fly   192 RINARARHILDAFGPDAYPAYQSSR---DLVAIVEQFATKENKNYASSPVK-------------K 240
            |:....:.:|.|.|..|....:.|:   ::...:::.||...:.::..||.             .
plant   208 RLGFSRQTVLAALGQAAVYNEEHSKPPPNIKNPLDEAATIVKEVFSMLPVYDIIVGALLTSGVWN 272

  Fly   241 TKKTSSSAIQVMTPISPMLASPCKSVEDAFKK-SPTGLYSEIKYDGERVQI-HKQGNDFKFFSRN 303
            ..||.:..:.|  |:.||||.....|:...:| ..|...:|.||||||.|| :.:....:.|||:
plant   273 LPKTCNLTLGV--PVRPMLAKATTRVDLILEKFKDTVFTAEYKYDGERAQIYYMEDGTVEIFSRH 335

  Fly   304 LK------PVVDHKIRALKKYIPQAFPGGGEMILDSEIILVDTDTGALLPFGSLGAHKKQTFAN- 361
            .:      |.|...:..|||...::|      |||.|::..:.:...:||..|..|||....:: 
plant   336 AERNTGKYPDVALVLSRLKKPTVKSF------ILDCEVVTFNREKEKILPLQSTRAHKNVNVSDI 394

  Fly   362 -AAVCLFVFDCILYDGEDLTQLPFRKRREILEQNIQPIKSHVQLSES----------EFLKTTRE 415
             ..||:|.||.:..:|:.|.......|||.|..:.:....:.|.:.:          ||||.:.:
plant   395 KVGVCVFAFDILYLNGQLLIHENLNIRREKLHDSFEEDLGYFQFATALTSNDIGELQEFLKASID 459

  Fly   416 LAAMTARVLHANLEGVVLKS--PTSTYQPGKR--NWLKVKKDYLFDGKMADTADLVVLGAWYGSG 476
            :..          ||:::||  ..:||:|.||  ||||:||||:  ..:.|:.|||.:..::|.|
plant   460 IGC----------EGLMIKSLYSNATYEPAKRSNNWLKLKKDYM--DNIGDSVDLVPIATFHGRG 512

  Fly   477 KKGGTLSIFLMGCYDAFGRLWKTVTKVHSGLDDATNAEVHKSLIKLTERADANAIPSWLLCSK-- 539
            |:.|....:|:.|||.....::::.|:.:...|....::..|                 ||||  
plant   513 KRTGFFGAYLLACYDVDKEEFQSICKIGTEFSDVELQDLSSS-----------------LCSKVI 560

  Fly   540 -----------SLVPDVLAKDPMKMPVWEITGAEFTKSDAHTAS--------GISVRFPRITRRR 585
                       .|.|||.. :|.:  |||:..|:.|.|..:..:        |||:||||:.|.|
plant   561 ATPKQYYQVDNDLNPDVWL-EPTE--VWEVKAADLTVSPVYREAIGIVDPDKGISLRFPRLVRIR 622

  Fly   586 SDKSAKEANDLAHLEDLFEASKSN 609
            .||:.:||.....:.::::|.|.|
plant   623 KDKNPEEATTSDQIAEMYQAQKHN 646

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DNAlig3NP_650187.2 DNA_ligase_A_N 36..200 CDD:282522 29/167 (17%)
dnl1 88..604 CDD:273147 146/580 (25%)
Adenylation_DNA_ligase_III 242..454 CDD:185712 71/236 (30%)
OBF_DNA_ligase_III 460..598 CDD:153436 43/159 (27%)
AT1G49250NP_175351.1 PLN03113 2..657 CDD:215584 167/675 (25%)
DNA_ligase_A_N 57..216 CDD:282522 39/197 (20%)
Adenylation_DNA_ligase_I_Euk 276..492 CDD:185710 70/234 (30%)
OBF_DNA_ligase_I 497..642 CDD:153438 43/165 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D274264at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45674
Phylome 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.