DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DNAlig3 and LIG1

Sequence 1:NP_650187.2 Gene:DNAlig3 FlyBaseID:FBgn0286075 Length:806 Species:Drosophila melanogaster
Sequence 2:NP_172293.2 Gene:LIG1 AraportID:AT1G08130 Length:790 Species:Arabidopsis thaliana

Alignment Length:651 Identity:163/652 (25%)
Similarity:266/652 (41%) Gaps:119/652 (18%)


  Fly    12 ILTRLLCNKMASKGLHNEDNKLDTFRRICDEIAGESSYLKKAERLQRFFEKGSSGKGFKGDTVLW 76
            ::|.:|||.:.:......::.:.|.....:|||                                
plant   195 VITDILCNMLRTVIATTPEDLVATVYLSANEIA-------------------------------- 227

  Fly    77 VQFLIPAANQRVYNLQNKALIKLFSRIFNADQQQMHLDLEQDGDVSETLR-KHFAASKKLKPQKQ 140
                 ||.......:....:||..|..|...:..:.....:.||:....: .....:...||:..
plant   228 -----PAHEGVELGIGESTIIKAISEAFGRTEDHVKKQNTELGDLGLVAKGSRSTQTMMFKPEPL 287

  Fly   141 SKLYLQEVEEMLLHLVERTKEDEQTDLLQKLCSKATDLDLRTFIRLVKHDLRINARARHILDAFG 205
            :.:.:.:....:.....:...:::.:.::.|....||.:.....||::..||:....:.:|.|.|
plant   288 TVVKVFDTFRQIAKESGKDSNEKKKNRMKALLVATTDCEPLYLTRLLQAKLRLGFSGQTVLAALG 352

  Fly   206 PDAYPAYQSSRDLVAIVEQFATKENKNYASSPVKKTKKTSSSAIQVM------------------ 252
            .            .|:..:..:|...| ..||:::..|.......|:                  
plant   353 Q------------AAVYNEEHSKPPPN-TKSPLEEAAKIVKQVFTVLPVYDIIVPALLSGGVWNL 404

  Fly   253 ---------TPISPMLASPCKSVEDAFKKSPTGLYS-EIKYDGERVQIH-KQGNDFKFFSRNLK- 305
                     .||.||||.|.|.|.:...|....::: |.||||||.||| .:...|:.:|||.: 
plant   405 PKTCNFTLGVPIGPMLAKPTKGVAEILNKFQDIVFTCEYKYDGERAQIHFMEDGTFEIYSRNAER 469

  Fly   306 -----PVVDHKIRALKKYIPQAFPGGGEMILDSEIILVDTDTGALLPFGSLGAH-KKQTFAN--- 361
                 |.|...:..|||      |.....|||.|::..|.:...:|||..|... :|....|   
plant   470 NTGKYPDVALALSRLKK------PSVKSFILDCEVVAFDREKKKILPFQILSTRARKNVNVNDIK 528

  Fly   362 AAVCLFVFDCILYDGEDLTQLPFRKRREILEQNIQPIKSHVQLSESEFLKTTRELAAMTARVLHA 426
            ..||:|.||.:..:|:.|.|...:.|||.|.::.:....:.|.:.:.......|:.......:..
plant   529 VGVCIFAFDMLYLNGQQLIQENLKIRREKLYESFEEDPGYFQFATAVTSNDIDEIQKFLDASVDV 593

  Fly   427 NLEGVVLKSPTS--TYQPGKR--NWLKVKKDYLFDGKMADTADLVVLGAWYGSGKKGGTLSIFLM 487
            ..||:::|:..|  ||:|.||  ||||:||||:  ..:.|:.|||.:.|::|.||:.|....||:
plant   594 GCEGLIIKTLDSDATYEPAKRSNNWLKLKKDYM--DSIGDSVDLVPIAAFHGRGKRTGVYGAFLL 656

  Fly   488 GCYDAFGRLWKTVTKVHSGLDDATNAEVHKSLIKLTERADANAIP-SWLLCSKSLVPDVLAKDPM 551
            .|||.....::::.|:.:|..||...|...||     |:...|.| .:.....||.|||.. :|.
plant   657 ACYDVDKEEFQSICKIGTGFSDAMLDERSSSL-----RSQVIATPKQYYRVGDSLNPDVWF-EPT 715

  Fly   552 KMPVWEITGAEFTKSDAHTAS--------GISVRFPRITRRRSDKSAKEANDLAHLEDLFEASKS 608
            :  |||:..|:.|.|..|.|:        |||:||||:.|.|.||..:||.....:.||::|.|.
plant   716 E--VWEVKAADLTISPVHRAATGIVDPDKGISLRFPRLLRVREDKKPEEATSSEQIADLYQAQKH 778

  Fly   609 N 609
            |
plant   779 N 779

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DNAlig3NP_650187.2 DNA_ligase_A_N 36..200 CDD:282522 20/165 (12%)
dnl1 88..604 CDD:273147 150/569 (26%)
Adenylation_DNA_ligase_III 242..454 CDD:185712 73/255 (29%)
OBF_DNA_ligase_III 460..598 CDD:153436 51/147 (35%)
LIG1NP_172293.2 PLN03113 49..790 CDD:215584 163/652 (25%)
DNA_ligase_A_N 176..347 CDD:282522 25/189 (13%)
Adenylation_DNA_ligase_I_Euk 407..625 CDD:185710 71/224 (32%)
OBF_DNA_ligase_I 630..775 CDD:153438 53/153 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D274264at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45674
Phylome 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.