DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DNAlig3 and ATLIG4

Sequence 1:NP_650187.2 Gene:DNAlig3 FlyBaseID:FBgn0286075 Length:806 Species:Drosophila melanogaster
Sequence 2:NP_568851.2 Gene:ATLIG4 AraportID:AT5G57160 Length:1219 Species:Arabidopsis thaliana

Alignment Length:714 Identity:180/715 (25%)
Similarity:292/715 (41%) Gaps:164/715 (23%)


  Fly   143 LYLQEVEEMLLHLVERTKEDEQTDLLQKLCSKATDLDLRTFIRLVKHDLRINARARHILDAFGPD 207
            |.::|:.::|..|.......|:|.:|..|..|....:::..||::..||::....:.|...|.||
plant   125 LTIKELNDLLDRLASSENRAEKTLVLSTLIQKTNAQEMKWVIRIILKDLKLGMSEKSIFQEFHPD 189

  Fly   208 AYPAYQSSRDLVAIVEQFATKENKNYASSPVKKTKKTSSSAIQVMTPISPMLASPCKSVEDAFKK 272
            |...:..:.||..:.|:...:..::            ....|:|...:.|.||.....|..|:||
plant   190 AEDLFNVTCDLKLVCEKLRDRHQRH------------KRQDIEVGKAVRPQLAMRIGDVNAAWKK 242

  Fly   273 -SPTGLYSEIKYDGERVQIHKQGNDFKFFSRNLKPVVDHK--IRALKKYIPQAFPGGGEMILDSE 334
             ....:.:|.|:||:|:||||.|.|..:||||.   :||.  ..|:...|.|... ..:.|||.|
plant   243 LHGKDVVAECKFDGDRIQIHKNGTDIHYFSRNF---LDHSEYAHAMSDLIVQNIL-VDKCILDGE 303

  Fly   335 IILVDTDTGALLPFGSLGAHKKQTFANAA---------VCLFVFDCILYDGE-DLTQLPFRKRRE 389
            :::.||.......|||     .|..|.||         :|...|| :||.|: .:.....::|.|
plant   304 MLVWDTSLNRFAEFGS-----NQEIAKAAREGLDSHKQLCYVAFD-VLYVGDTSVIHQSLKERHE 362

  Fly   390 ILEQNIQPIKSHVQL----------------SESEFLKTTRELAAMTARVLHANLEGVVLKSPTS 438
            :|::.::|:|..:::                |.|..:....::.......:....||:|||...|
plant   363 LLKKVVKPLKGRLEVLVPEGGLNVHRPSGEPSWSIVVHAAADVERFFKETVENRDEGIVLKDLES 427

  Fly   439 TYQPGKRN--WLKVKKDYLFDGKMADTADLVVLGAWYGSGKKGGTLSIFLMGCYD-----AFGRL 496
            .::||.|:  |:|:|.:|:..|  || .|::::|.:||||::||.::.||:...|     .:.|.
plant   428 KWEPGDRSGKWMKLKPEYIRAG--AD-LDVLIIGGYYGSGRRGGEVAQFLVALADRAEANVYPRR 489

  Fly   497 WKTVTKVHSGL-DDATNAEVHKSLIKLTERADAN---AIPSWLLC---SKSLVPDVLAKDPMKMP 554
            :.:..:|.:|| ||..|..|.|  :|...|.:.:   |.||:...   ||.. |||....|.|..
plant   490 FMSFCRVGTGLSDDELNTVVSK--LKPYFRKNEHPKKAPPSFYQVTNHSKER-PDVWIDSPEKSI 551

  Fly   555 VWEITGAEFTKSDAHT------ASGISVRFPRITRRRSDKSAKEANDLAHLEDLFEASKSNVNVD 613
            :..||      ||..|      .:..|:|||||.:.|.||...|..|:....:|..:|       
plant   552 ILSIT------SDIRTIRSEVFVAPYSLRFPRIDKVRYDKPWHECLDVQAFVELVNSS------- 603

  Fly   614 LLLANCSKDETAMNNKTTPEKEKKLNGNQSNGSKKLKRSNTGSDDEDGAPVLSKRKESKAIRSLS 678
                          |.|| :|:|:....|.|  .|:.:|             |||.|.|.: ||.
plant   604 --------------NGTT-QKQKESESTQDN--PKVNKS-------------SKRGEKKNV-SLV 637

  Fly   679 PSQKGLKDFFKPSKEFKSVVKKEPKEDEGNIESTSSKPQLFEGLVAHFAMEKDSSKL---MQQFS 740
            |||     |.                 :.::.....|..:|..::.:|.....|..|   .:...
plant   638 PSQ-----FI-----------------QTDVSDIKGKTSIFSNMIFYFVNVPRSHSLETFHKMVV 680

  Fly   741 QHGGCCTTEPQKADLVFYANTNEA----LDLEKLRTLYRRSCRHLNV---SWLQSCLDTQSRQP 797
            ::||           .|..|.|.:    :..|.....|:.:.|..:|   ||:..|.......|
plant   681 ENGG-----------KFSMNLNNSVTHCIAAESSGIKYQAAKRQRDVIHFSWVLDCCSRNKMLP 733

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DNAlig3NP_650187.2 DNA_ligase_A_N 36..200 CDD:282522 13/57 (23%)
dnl1 88..604 CDD:273147 141/510 (28%)
Adenylation_DNA_ligase_III 242..454 CDD:185712 67/243 (28%)
OBF_DNA_ligase_III 460..598 CDD:153436 50/156 (32%)
ATLIG4NP_568851.2 DNA_ligase_A_N 6..182 CDD:282522 13/57 (23%)
dnl1 61..600 CDD:273147 141/509 (28%)
Adenylation_DNA_ligase_IV 215..446 CDD:185713 68/241 (28%)
OBF_DNA_ligase_IV 449..593 CDD:153437 51/156 (33%)
BRCT 655..726 CDD:214602 16/82 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D274264at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.