DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DNAlig3 and Lig1

Sequence 1:NP_650187.2 Gene:DNAlig3 FlyBaseID:FBgn0286075 Length:806 Species:Drosophila melanogaster
Sequence 2:NP_001019439.1 Gene:Lig1 RGDID:621424 Length:913 Species:Rattus norvegicus

Alignment Length:670 Identity:162/671 (24%)
Similarity:252/671 (38%) Gaps:202/671 (30%)


  Fly    36 FRRICD--EIAGESSYLKKAERLQ-----------RFFEKGSSGKGFKGDTVLWVQFLIPAANQR 87
            |.:.||  .:.|.:|..||.:.::           ||..:..||:...|   |..|.::.|..|.
  Rat   400 FTKFCDIARLTGSASMAKKMDIIKGLFVACRYSEARFIARSLSGRLRLG---LAEQSVLAALAQA 461

  Fly    88 VYNLQNKALIKLFSRIFNADQQQMHLDLEQDGDVSETLRKHFAASKKLKPQKQSKLYLQEVEEML 152
            |                         .|...|....|.   ...:.|.|..:..|::|       
  Rat   462 V-------------------------SLTPPGQEFPTA---VVDAGKGKTAEARKMWL------- 491

  Fly   153 LHLVERTKEDEQTDLLQKLCSKATDLDLRTFIRLVKHDLRINARARHILDAFGPDAYPAYQSSRD 217
                     :||..:|::...:..||| |....|::|               |.::.|.:     
  Rat   492 ---------EEQGMILKQTFCEVPDLD-RIIPVLLEH---------------GLESLPEH----- 526

  Fly   218 LVAIVEQFATKENKNYASSPVKKTKKTSSSAIQVMTPISPMLASPCKSVEDAFKK-SPTGLYSEI 281
                                         ..:....|:.||||.|.:.|.:..|: .......|.
  Rat   527 -----------------------------CKLSPGVPLKPMLAHPTRGVREVLKRFEEVDFTCEY 562

  Fly   282 KYDGERVQIH-KQGNDFKFFSRNLK------PVVDHKIRALKKYIPQAFPGGGEMILDSEIILVD 339
            ||||:|.||| .:|.:.|.||||.:      |.:..:|..:|      .|.....|||:|.:..|
  Rat   563 KYDGQRAQIHVLEGGEVKIFSRNQEDNSGKYPDIISRIPKIK------HPSVTSFILDTEAVAWD 621

  Fly   340 TDTGALLPFGSLGAHKKQ----TFANAAVCLFVFDCILYDGEDLTQLPFRKRREILEQNIQPIKS 400
            .:...:.||..|...|::    :.....|||:.||.|..:||.|.:.|..:||::|.:|....:.
  Rat   622 REKKQIQPFQVLTTRKRKEVDASEIQVQVCLYAFDLIYLNGESLARQPLSRRRQLLRENFVETEG 686

  Fly   401 HVQLSESEFLKTTRELAAMTARVLHANLEGVVLKS--PTSTYQPGKR--NWLKVKKDYLFDGKMA 461
            ....:.|...|...::|....:.:..:.||:::|:  ..:||:..||  ||||:||||| :| :.
  Rat   687 EFVFATSLDTKDIEQIAEFLEQSVKDSCEGLMVKTLDVDATYEIAKRSHNWLKLKKDYL-EG-VG 749

  Fly   462 DTADLVVLGAWYGSGKKGGTLSIFLMGCYDAFGRLWKTVTKVHSGLDDATNAEVHKSLIKLT--- 523
            ||.||||:||:.|.||:.|....||:..||......:.:.|:.:|..|....|.|:|:..|.   
  Rat   750 DTLDLVVIGAYLGRGKRAGRYGGFLLAAYDEESEELQAICKLGTGFSDEELEEHHQSMQALLLPT 814

  Fly   524 ----ERADANAIPS-WLLCSKSLVPDVLAKDPMKMPVWEITGAEFTKSDAHTAS--------GIS 575
                .|.|....|. ||             ||  ..|||:..|:.:.|..:.|:        |||
  Rat   815 PRPYVRIDGAVAPDHWL-------------DP--SVVWEVKCADLSLSPIYPAARGLVDKEKGIS 864

  Fly   576 VRFPRITRRRSDKSAKEANDLAHLEDLFEASKSNVNVDLLLANCSKDETAMNNKTTPEKEKKLNG 640
            :||||..|.|.||..::|.....:..|:                             .|:.::..
  Rat   865 LRFPRFIRVREDKQPEQATTSDQVASLY-----------------------------RKQSQIQN 900

  Fly   641 NQSNGSKKLKRSNTGSDDED 660
            .||        |:..||.||
  Rat   901 QQS--------SDLDSDVED 912

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DNAlig3NP_650187.2 DNA_ligase_A_N 36..200 CDD:282522 33/177 (19%)
dnl1 88..604 CDD:273147 138/548 (25%)
Adenylation_DNA_ligase_III 242..454 CDD:185712 67/228 (29%)
OBF_DNA_ligase_III 460..598 CDD:153436 48/154 (31%)
Lig1NP_001019439.1 PLN03113 159..909 CDD:215584 159/666 (24%)
DNA_ligase_A_N 283..454 CDD:282522 14/57 (25%)
Adenylation_DNA_ligase_I_Euk 526..744 CDD:185710 67/258 (26%)
OBF_DNA_ligase_I 749..894 CDD:153438 49/189 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1793
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D274264at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.