DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DNAlig3 and lig4

Sequence 1:NP_650187.2 Gene:DNAlig3 FlyBaseID:FBgn0286075 Length:806 Species:Drosophila melanogaster
Sequence 2:NP_001096593.1 Gene:lig4 ZFINID:ZDB-GENE-070820-10 Length:909 Species:Danio rerio

Alignment Length:776 Identity:189/777 (24%)
Similarity:330/777 (42%) Gaps:145/777 (19%)


  Fly    77 VQFLIPA--ANQRVYNLQNKALIKLFSRIF----NADQQQMHLDLE----QDGDVSE-TLRKHFA 130
            ::.::|:  ..:..|.::...|.||:..:.    |.|:....|:..    ..|:..: .|..:|.
Zfish    73 MRLIVPSFERERMAYGIKENMLAKLYIEVLGLPKNGDEANKLLNYRAPTTSQGEAGDFALMAYFV 137

  Fly   131 ASKKLKPQKQSKLYLQEVEEMLLHLVERTKEDEQTDLLQK----LCSKATDLDLRTFIRLVKHDL 191
            ..|:.  ..|..|.::||.: .|..|......:|.|.::|    |.::::.|:.:..||::..|:
Zfish   138 LKKRC--TSQGNLSIKEVND-FLGSVATNNASKQKDQVKKSLLHLITQSSALEQKWLIRMILKDM 199

  Fly   192 RINARARHILDAFGPDAYPAYQSSRDLVAIVEQFATKENKNYASSPVKKTKKTSSSAIQVMTPIS 256
            ::......:|..|.|||...|..:.||..:..|.         ..|   :...|..:|.:.:...
Zfish   200 KLGISKETVLQVFHPDAPEFYNVTTDLNKVCRQL---------HDP---SVSLSEVSIDLFSAFK 252

  Fly   257 PMLASPC--KSVEDAFKKSPTGLYSEIKYDGERVQIHKQGNDFKFFSRN---------LKPVVDH 310
            ||||:..  :.:|......|  .|.|.|.||||:|:||.|:.:|:::||         ..|:.. 
Zfish   253 PMLAAVANIRQIEKQMGNRP--FYIETKLDGERIQLHKAGDVYKYYTRNSYEYTQQFGASPLEG- 314

  Fly   311 KIRALKKYIPQAF-PGGGEMILDSEIILVDTDTGALLPFGSLGAHKKQT-FANAAVCLFVFDCIL 373
               :|..||...| |.....|||.|::..:..|...:..||....|:.. .::...|..|||.:|
Zfish   315 ---SLTPYIHTVFSPHVVNCILDGEMMAYNPKTETFMQKGSKFDIKRLVDDSDLQTCFCVFDVLL 376

  Fly   374 YDGEDLTQLPFRKRREILEQNIQPIKSHVQLSESEFLKTTRELAAMTARVLHANLEGVVLKSPTS 438
            .:.:...:.|.:||.|.||....|||..:.|......:|.:|:.......:....||:::|.|.|
Zfish   377 INNQKFGKEPLKKRYESLETVFSPIKGRIHLVSKSEGRTMQEVVNSLNEAIDNREEGIMVKDPMS 441

  Fly   439 TYQPGKR--NWLKVKKDYLFDGKMADTADLVVLGAWYGSGKKGGTLSIFLMGCYDAFG-----RL 496
            .|:|.||  .|||:|.:|: ||.| |..||:::|.::|.|::.|.||.||....:...     .:
Zfish   442 IYKPDKRGEGWLKIKPEYV-DGLM-DELDLLIVGGYWGKGRRSGMLSHFLCAVAEVPSPGEKPTV 504

  Fly   497 WKTVTKVHSGLDDATNAEVHKSLIKLTER---ADANAIPSWLLCSKSLVPDVLAKDPMKMPVWEI 558
            :.|:.::.||.   |..|::...:||.:.   .:.|..|:.:||... .|:|.. :|....:.::
Zfish   505 FHTLCRIGSGY---TLKELYDLGVKLAKHWKVYNKNNPPAAILCGTE-KPEVYI-EPRNSVILQV 564

  Fly   559 TGAEFTKSDAHTASGISVRFPRITRRRSDKSAKEANDLAHLEDLFE-ASKSNVNVDLLLANCSKD 622
            ..||...|:.: .:..::|||||.|.|.|   ||.:....|:||.: .||::..:.....|..:|
Zfish   565 KAAEIVTSEMY-KTDCTLRFPRIERIRED---KEWHQCMTLDDLNQFRSKASGKLASRHLNIHED 625

  Fly   623 ETAMNNKTTPEKEKKLNGNQSNGSKKLKRSNTGSDDEDGAPVLSKRKESKAIRSLSPSQKGLKDF 687
            :        |||:|:                         .:::|.|  |.|        |:.|.
Zfish   626 Q--------PEKKKR-------------------------KIVAKPK--KTI--------GVIDH 647

  Fly   688 FKPSKEFKSVVKKEPKEDEG-----NIESTSSKPQLFEGLVAHFAMEKDSSKLMQQFSQHGGCCT 747
            || |::...|.|:....:|.     |.:...||.:|.:|:                 ::.||...
Zfish   648 FK-SQDLSKVAKETDMFEEVEFCVINGDDEHSKAELEKGV-----------------ARCGGIVV 694

  Fly   748 TEPQKADLVFYANTNEALDLEKLRTLYRRSCRH--LNVSWLQSCLDTQSRQPF-PLHAVMM 805
            ..|.|......|    |:...:::.|. .|.:|  :..:||..||:.:...|: |.|.:.|
Zfish   695 QNPGKDTYCAIA----AVQNMRVKNLI-SSDQHDVVWATWLLECLENKQVIPWQPRHMIHM 750

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DNAlig3NP_650187.2 DNA_ligase_A_N 36..200 CDD:282522 26/138 (19%)
dnl1 88..604 CDD:273147 146/552 (26%)
Adenylation_DNA_ligase_III 242..454 CDD:185712 66/227 (29%)
OBF_DNA_ligase_III 460..598 CDD:153436 39/146 (27%)
lig4NP_001096593.1 DNA_ligase_A_N 20..208 CDD:282522 26/138 (19%)
dnl1 86..606 CDD:273147 146/552 (26%)
Adenylation_DNA_ligase_IV 240..461 CDD:185713 67/228 (29%)
OBF_DNA_ligase_IV 464..601 CDD:153437 39/147 (27%)
DNA_ligase_IV 754..786 CDD:288294
BRCT <845..896 CDD:278934
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1793
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D189866at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.