DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DNAlig3 and lig3

Sequence 1:NP_650187.2 Gene:DNAlig3 FlyBaseID:FBgn0286075 Length:806 Species:Drosophila melanogaster
Sequence 2:NP_001025345.2 Gene:lig3 ZFINID:ZDB-GENE-030131-8453 Length:1011 Species:Danio rerio

Alignment Length:817 Identity:339/818 (41%)
Similarity:470/818 (57%) Gaps:77/818 (9%)


  Fly     9 QARILTRLLCNKMASKGLHNEDNKLDTFRRICDEIAGESSYLKKAERLQRFFEKGSSGKGFKGDT 73
            |..:|:..:|:..      ::||.|..||::|..:|.:|.|..|.|.::.|..|||.|..|:||.
Zfish   244 QGSVLSAQMCDPT------HKDNLLREFRKLCALVAEKSGYNAKTEIVRDFLTKGSGGDKFRGDL 302

  Fly    74 VLWVQFLIPAANQRVYNLQNKALIKLFSRIFNADQQQMHLDLEQDGDVSETLRKHFAASKKLKPQ 138
            .|.|:.|:|...:.||||.:|.::||||||.|.:|..|..|||| ||||||:|..|..||...|.
Zfish   303 YLTVKLLLPGVVKNVYNLNDKQIVKLFSRILNCNQDDMVQDLEQ-GDVSETVRMFFEESKSFPPS 366

  Fly   139 KQSKLYLQEVEEMLLHLVERTKEDEQTDLLQKLCSKATDLDLRTFIRLVKHDLRINARARHILDA 203
            .:|.|.:|||:..|..|.:.||||:|...||.:..|.|..||:.:||||||||:||:.|:|||||
Zfish   367 AKSLLTIQEVDASLSRLSQLTKEDDQQAELQSIAKKCTGNDLKCYIRLVKHDLKINSGAKHILDA 431

  Fly   204 FGPDAYPAYQSSRDLVAIVEQ-FATKENKNYASSPVKKTKKTSSSAIQVMTPISPMLASPCKSVE 267
            ..|:||.|:::||:|..:::: ...:::.:..:.|    :|..|....:|||:.||||..|||:|
Zfish   432 VDPNAYDAFKASRNLGDVIDRVLRNQQDASNGTGP----RKILSIEASLMTPVQPMLAEACKSIE 492

  Fly   268 DAFKKSPTGLYSEIKYDGERVQIHKQGNDFKFFSRNLKPVVDHKIRALKKYIPQAFPGGGEMILD 332
            .|.||.|.|:||||||||||||:||.||.|.:|||:||||:.||:...|.:|||||.||..||||
Zfish   493 YAMKKCPNGMYSEIKYDGERVQVHKNGNHFSYFSRSLKPVLPHKVAHFKDFIPQAFAGGHSMILD 557

  Fly   333 SEIILVDTDTGALLPFGSLGAHKKQTFANAAVCLFVFDCILYDGEDLTQLPFRKRREILEQNIQP 397
            :|::|:||.|...||||:||.|||..|.:|.|.|||||||.::|..|...|..:||:.|..|:..
Zfish   558 AEVLLIDTKTSKPLPFGTLGVHKKAAFQDAQVGLFVFDCIYFNGVSLMDKPLCERRKFLHDNMVE 622

  Fly   398 IKSHVQLSESEFLKTTRELAAMTARVLHANLEGVVLKSPTSTYQPGKRNWLKVKKDYLFDGKMAD 462
            :.:.:..||.:.:....:||.|..||:...|||:|||.....|:||||:|||||||||.:|.|||
Zfish   623 VPNRILFSEMKHVTRAPDLAEMITRVIREGLEGLVLKDIKGLYEPGKRHWLKVKKDYLNEGAMAD 687

  Fly   463 TADLVVLGAWYGSGKKGGTLSIFLMGCYDAFGRLWKTVTKVHSGLDDATNAEVHKSLIKLTERAD 527
            |||||||||:||.|..||.:|.|||||||...|.|.||||...|.|||....:.|.|..:....|
Zfish   688 TADLVVLGAFYGKGSNGGIMSSFLMGCYDPESRKWCTVTKCSGGFDDAMLDRLQKDLDVIKIGKD 752

  Fly   528 ANAIPSWLLCSKSLVPDVLAKDPMKMPVWEITGAEFTKSDAHTASGISVRFPRITRRRSDKSAKE 592
            .:.||.||...|:..||.:.:||.|.||||||||||:||:.|||.|||:||||.||.|.||..|.
Zfish   753 PSKIPGWLKIVKNYYPDFIIRDPQKAPVWEITGAEFSKSEMHTADGISIRFPRCTRMRDDKDWKT 817

  Fly   593 ANDLAHLEDLFEASKSNVNVDLLLANCSKDETAMNNKTTPEKEKKLNGNQSNGS----------- 646
            |.:|..|::|:..||.         ||..:.||..:|.. :.:|..:|.:|.||           
Zfish   818 ATNLQQLKELYRISKE---------NCDFEVTAGPSKAN-QNDKSSSGGESGGSSPSASRGASTA 872

  Fly   647 KKLKRSNT----GSDDEDGAPVL-----SKRKESKAIRSLSPSQKGLKDFFKPSKEFKSVVKKEP 702
            .|.|..:|    .:..|..||.:     :::::.|.|::.|....|       ..:.|||...:|
Zfish   873 NKPKNGHTPKAKAAKTESSAPAVKRKLPAEKQDVKKIKTESVHSNG-------QSKLKSVPTTDP 930

  Fly   703 KEDEGNIESTSSKPQLFEGLVAHFAME-KDSSKLMQQFSQHGGCCTTEPQKADLVFYANTNEALD 766
            |:::..::       :|.|:..:.... ||..||.:.|..:.|         |||  ...:.|| 
Zfish   931 KQEKTLLD-------IFTGVKLYLPESVKDFEKLRRYFLAYDG---------DLV--PEYDSAL- 976

  Fly   767 LEKLRTLYR----RSCRHLNVSWLQSCLDTQSRQPFP 799
              ...||.:    .|.:.:..:|:..|:  :.|:..|
Zfish   977 --ATHTLGQPEDGSSAQKVTSNWIWECI--RKRRVVP 1009

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DNAlig3NP_650187.2 DNA_ligase_A_N 36..200 CDD:282522 79/164 (48%)
dnl1 88..604 CDD:273147 266/517 (51%)
Adenylation_DNA_ligase_III 242..454 CDD:185712 112/212 (53%)
OBF_DNA_ligase_III 460..598 CDD:153436 78/138 (57%)
lig3NP_001025345.2 zf-PARP 95..178 CDD:279039
DNA_ligase_A_N 263..428 CDD:282522 79/166 (48%)
dnl1 317..829 CDD:273147 266/517 (51%)
Adenylation_DNA_ligase_III 467..679 CDD:185712 112/212 (53%)
OBF_DNA_ligase_III 685..823 CDD:153436 78/138 (57%)
LIG3_BRCT 935..1006 CDD:293364 19/94 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C322364423
eggNOG 1 0.900 E1_COG1793
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H32109
Inparanoid 1 1.050 507 1.000 Inparanoid score I1270
OMA 1 1.010
OrthoDB 1 1.010 D189866at33208
OrthoFinder 1 1.000 FOG0007850
OrthoInspector 1 1.000 T1053343
orthoMCL 1 0.900 OOG5_134498
Panther 1 1.100 LDO PTHR45674
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3850
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1312.800

Return to query results.
Submit another query.