DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DNAlig3 and lig1

Sequence 1:NP_650187.2 Gene:DNAlig3 FlyBaseID:FBgn0286075 Length:806 Species:Drosophila melanogaster
Sequence 2:NP_001119860.1 Gene:lig1 ZFINID:ZDB-GENE-110404-2 Length:1058 Species:Danio rerio

Alignment Length:669 Identity:165/670 (25%)
Similarity:283/670 (42%) Gaps:120/670 (18%)


  Fly    38 RICDEIAGESSYLKKAERLQRFFEKGSSGKGFKGDTVLWVQFLI-----PAANQRVYNLQNKALI 97
            |..::|..:|..||..|.|..|..   |......|.:|...:|.     ||.......:....|:
Zfish   436 RTFEKIEEDSGRLKNIETLSNFLR---SVILLSPDDLLCCVYLCLNQLGPAYQGLELGIGETVLM 497

  Fly    98 KLFSRIFNADQQQMHLDLEQDGD---VSETLRKH----FAASKKLKPQKQSKLYLQEVEEMLLHL 155
            |..::.......::..:.::.||   |:|:.|.:    ||.:........:||      :.:.|:
Zfish   498 KAVAQATGRQLDKIKAEAQEKGDLGLVAESSRSNQRMMFAPANLTAGGVFNKL------KEIAHM 556

  Fly   156 VERTKEDEQTDLLQKLCSKATDLDLRTFIRLVKHDLRINARARHILDAF---------GPDAYPA 211
            ...:..:::.|:::.|.......:.|..:|.:...|||....:.:|.|.         |.:..||
Zfish   557 SGNSAMNKKIDIIKGLFVACRFSEARYIVRSLAGKLRIGLAEQSVLAALSQAVCLTPPGQEFPPA 621

  Fly   212 Y------QSSRDLVAIVEQFATKENKNYASSPVKKTKKTSSSAIQVM-----------------T 253
            .      .|:.:....:|:.|....:.|...|      ...:.|.|:                 .
Zfish   622 VLDAGKGMSTENRRVFLEEKALILKQTYCEMP------NYDAIIPVLLKEGIDELPNHCKLTPGV 680

  Fly   254 PISPMLASPCKSVEDAFKKSPTGLYS-EIKYDGERVQIH-KQGNDFKFFSRNLK------PVVDH 310
            |:.||||.|.|.|.:..|:.....:: |.||||||.||| .:..:.:.||||.:      |.:..
Zfish   681 PLRPMLAHPTKGVGEVMKRFDEASFTCEYKYDGERAQIHILENGEVRIFSRNQEDNTSKYPDIIS 745

  Fly   311 KIRALKKYIPQAFPGGGEMILDSEIILVDTDTGALLPFGSLGAHKKQ----TFANAAVCLFVFDC 371
            :|..:||...::      .:||||.:..|.:...:.||..|...|::    :.....||::.||.
Zfish   746 RIPQVKKESVRS------CVLDSEAVAWDREKKQIQPFQVLTTRKRKDVDASEIKVQVCVYAFDL 804

  Fly   372 ILYDGEDLTQLPFRKRREILEQNIQPIKSHVQLSESEFLKTTRELAAMTARVLHANLEGVVLKS- 435
            :..:||.|.:.|..|||.:|.::....:.....:.|.....|..:|....:.:..:.||:::|: 
Zfish   805 LYLNGESLVREPLSKRRALLRESFVEKEGEFVFARSLDADNTETIAEFLEQSVRDSCEGLMVKTL 869

  Fly   436 -PTSTYQPGKR--NWLKVKKDYLFDGKMADTADLVVLGAWYGSGKKGGTLSIFLMGCYDAFGRLW 497
             ..:||:..||  ||||:||||| :| :.||.||.|:||:.|.||:.|....||:.|||.....:
Zfish   870 EKHATYEIAKRSHNWLKLKKDYL-EG-VGDTVDLCVIGAYLGKGKRAGGYGGFLLACYDEENEEF 932

  Fly   498 KTVTKVHSGLDDATNAEVHKSLIKLTERADANAIPS---WLLCSKSLVPDVLAKDPMKMPVWEIT 559
            ::|.|:.:|..| .:.|.|.:.:|      .:.:|.   :....:|..|||..:   .:.|||:.
Zfish   933 QSVCKIGTGFKD-EDLEQHYNFLK------EHILPKPRPYYRVDQSAEPDVWLE---AVQVWEVK 987

  Fly   560 GAEFTKSDAHTAS--------GISVRFPRITRRRSDKSAKEANDLAHLEDLFEASKSNVNVDLLL 616
            .|:.:.|..:.|:        |||:||||..|.|.||..::|...:.:.||::            
Zfish   988 CADLSLSPVYKAAMGLVDPEKGISLRFPRFLRIRDDKKPEDATTGSQIADLYK------------ 1040

  Fly   617 ANCSKDETAMNNKTTPEKE 635
                |.:...|....|:.|
Zfish  1041 ----KQQQIQNQGDKPDLE 1055

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DNAlig3NP_650187.2 DNA_ligase_A_N 36..200 CDD:282522 33/174 (19%)
dnl1 88..604 CDD:273147 147/582 (25%)
Adenylation_DNA_ligase_III 242..454 CDD:185712 67/245 (27%)
OBF_DNA_ligase_III 460..598 CDD:153436 46/149 (31%)
lig1NP_001119860.1 PLN03113 301..1053 CDD:215584 164/666 (25%)
DNA_ligase_A_N 430..601 CDD:282522 33/174 (19%)
Adenylation_DNA_ligase_I_Euk 673..891 CDD:185710 65/224 (29%)
OBF_DNA_ligase_I 896..1041 CDD:153438 48/171 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1793
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D274264at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.