DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DNAlig3 and lig4

Sequence 1:NP_650187.2 Gene:DNAlig3 FlyBaseID:FBgn0286075 Length:806 Species:Drosophila melanogaster
Sequence 2:NP_001016981.1 Gene:lig4 XenbaseID:XB-GENE-964443 Length:911 Species:Xenopus tropicalis

Alignment Length:866 Identity:209/867 (24%)
Similarity:354/867 (41%) Gaps:203/867 (23%)


  Fly    50 LKKAERLQRFFEKGSSGKGFKGDTVLWVQF---------------------LIPAANQR--VYNL 91
            |:|.::.:...||....|.|...   |.:|                     ::|...:.  .|.:
 Frog    28 LEKVQKCKNRTEKSHIFKQFVDS---WRKFHEALHKSQPKTTDSFYPAMRLVVPQLERERMAYGI 89

  Fly    92 QNKALIKLFSRIFNADQQQMHLDLEQDG-DVSETLR------KH-----FAASK----KLKPQKQ 140
            :...|.||:.::         |.|.::| |..:.|.      .|     |||..    |.:.:|:
 Frog    90 KETMLAKLYIKV---------LGLPKEGKDAIKLLNYRSPTSSHSDAGDFAAIAYFVLKSRCRKE 145

  Fly   141 SKLYLQEVEEMLLHL--VERTKEDEQTDLLQK----LCSKATDLDLRTFIRLVKHDLRINARARH 199
            ..|.:|||.   .||  :......::.:|::|    |.:..|.|:.:..||::..|:::....:.
 Frog   146 GSLSIQEVN---YHLDSIANNNAAKKKELIEKSLLHLIANTTALEQKWLIRMIIKDMKLGFSQQT 207

  Fly   200 ILDAFGPDAYPAYQSSRDLVAIVEQFATKENKNYASSPVKKTKKTSSSAIQVMTPISPMLASPCK 264
            :...|.|||...:..:.||..:..|.   .:.|...|.|         :|.:.:...||||: ..
 Frog   208 VFSIFHPDAAELHNVTTDLEKVCIQL---HDPNVCLSDV---------SISMFSAFKPMLAA-IA 259

  Fly   265 SVEDAFKK-SPTGLYSEIKYDGERVQIHKQGNDFKFFSRN---------LKPVVDHKIRALKKYI 319
            ::::..|: :....|.|.|.||||:|:||.|:.:|:||||         ..|:..    :|..||
 Frog   260 NIQNIEKQMNHQSFYIETKLDGERMQMHKDGDVYKYFSRNGFDYTQQFGASPLEG----SLTPYI 320

  Fly   320 PQAFP-GGGEMILDSEIILVDTDTGALLPFGSLGAHKKQT-FANAAVCLFVFDCILYDGEDLTQL 382
            ..||. .....|||.|::..:.:|...:..|:....|:.. .:....|..|||.:|.:.:.|...
 Frog   321 HNAFSLNIQNCILDGEMMAYNPNTQTFMQKGNKFDIKRMVDDSELQTCYCVFDVLLLNDQKLAHE 385

  Fly   383 PFRKRREILEQNIQPIKSHVQLSESEFLKTTRELAAMTARVLHANLEGVVLKSPTSTYQPGKR-- 445
            ..|||.:||::...||.....:.:.....|.:.:.......:....||:::|.|.|.|:|.||  
 Frog   386 TLRKRYDILQEIFIPIPGRFHIVDKTEASTKKNVVDALNEAIDKREEGIMVKDPMSIYKPDKRGE 450

  Fly   446 NWLKVKKDYLFDGKMADTADLVVLGAWYGSGKKGGTLSIFLMGCYDAFG-----RLWKTVTKVHS 505
            .|||:|.:|: :|.| |..||:::|.::|.|.:||.:|.||.|..:|.|     .::.::.:|.|
 Frog   451 GWLKIKPEYV-NGLM-DELDLIIIGGYWGKGSRGGMMSHFLCGVAEASGPGEKPSVFHSICRVGS 513

  Fly   506 GLDDATNAEVHKSLIKLT------ERADANAIPSWLLCSKSLVPDVLAKDPMKMPVWEITGAEFT 564
            |.   |..|:....:||.      .:.|.   ||.:||... .|:...: |....:.:|..||..
 Frog   514 GY---TMKELFDLGLKLAPHWKTYRKRDP---PSNILCGIE-KPEAYIQ-PCNSVIVQIKAAEIV 570

  Fly   565 KSDAHTASGISVRFPRITRRRSDKSAKEANDLAHLEDLFE---------ASKSNVNVDLLLANCS 620
            .||.: .:|.::|||||.:.|.|   ||..|...|:||.:         ||| ::::|       
 Frog   571 TSDMY-KTGCTLRFPRIEKIRED---KEWYDCMTLDDLEQFRDKASGKLASK-HLHID------- 623

  Fly   621 KDETAMNNKTTPEKEKKLNGNQSNGSKKLKRSN----------------TGSD---DEDGAPVLS 666
             ||.....:.|..|.||:.|..|: .|....||                :|:|   .:|.|.:::
 Frog   624 -DEPHEKKRKTAPKLKKVIGIVSH-LKAPDLSNVYQESSVFAEVEFCVMSGTDTHSKDDLANIIA 686

  Fly   667 K------------------RKESKAIRSLSPSQKGLKDFFKPS-----KEFKSVVKKEPKEDEGN 708
            |                  ..|:..::::..|.|  .|..|.:     .|.|:.|..:|......
 Frog   687 KCGGIGVQNPGADTYCVIAGTENVRVKNIICSNK--HDVVKAAWLLECFESKTFVPWQPHHMIHM 749

  Fly   709 IESTSSKPQLFEGLVAHFAMEKDSSKLMQQFSQHGGCCTTEPQKADL--VFY--ANTNEALDLEK 769
            ..||:.          |||.|.|.         :|....|:..:..|  ||:  :|..|.:..|.
 Frog   750 CPSTAE----------HFACEYDC---------YGDSYITDTSEYQLREVFHRMSNIREKIPFEM 795

  Fly   770 LRTLYRR-SCRHLNVSWLQSC 789
            :..|..| |..:.:.|:.:.|
 Frog   796 MADLEERYSWNNSSHSFFRHC 816

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DNAlig3NP_650187.2 DNA_ligase_A_N 36..200 CDD:282522 38/195 (19%)
dnl1 88..604 CDD:273147 151/563 (27%)
Adenylation_DNA_ligase_III 242..454 CDD:185712 62/226 (27%)
OBF_DNA_ligase_III 460..598 CDD:153436 45/149 (30%)
lig4NP_001016981.1 DNA_ligase_A_N 20..208 CDD:282522 38/195 (19%)
dnl1 86..606 CDD:273147 151/563 (27%)
Adenylation_DNA_ligase_IV 240..461 CDD:185713 65/236 (28%)
OBF_DNA_ligase_IV 464..601 CDD:153437 45/150 (30%)
BRCT 659..733 CDD:214602 10/76 (13%)
DNA_ligase_IV 753..786 CDD:288294 11/52 (21%)
BRCT 809..898 CDD:278934 2/9 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1793
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D189866at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.