DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DNAlig3 and lig3

Sequence 1:NP_650187.2 Gene:DNAlig3 FlyBaseID:FBgn0286075 Length:806 Species:Drosophila melanogaster
Sequence 2:XP_012827218.1 Gene:lig3 XenbaseID:XB-GENE-5788004 Length:982 Species:Xenopus tropicalis

Alignment Length:787 Identity:335/788 (43%)
Similarity:467/788 (59%) Gaps:59/788 (7%)


  Fly    28 NEDNKLDTFRRICDEIAGESSYLKKAERLQRFFEKGSSGKGFKGDTVLWVQFLIPAANQRVYNLQ 92
            ::|..|..||::|..:|.:.||..|.:.::.|..||:||.||.|||.|.|:.|:|...:.||||.
 Frog   222 HKDCLLREFRKLCAMVAEQPSYNSKTQIIRDFLTKGTSGDGFHGDTYLTVKLLLPGVIKSVYNLN 286

  Fly    93 NKALIKLFSRIFNADQQQMHLDLEQDGDVSETLRKHFAASKKLKPQKQSKLYLQEVEEMLLHLVE 157
            :|.::|.||||||.:|::|..|||| ||||||:|..|..||...|..:|.|.:.||:::|..|.:
 Frog   287 DKQIVKHFSRIFNCNQEEMVRDLEQ-GDVSETVRIFFEESKCFAPASKSLLTIHEVDDLLTKLSK 350

  Fly   158 RTKEDEQTDLLQKLCSKATDLDLRTFIRLVKHDLRINARARHILDAFGPDAYPAYQSSRDLVAIV 222
            .|||::|.::|:.:..:.|..||:..|||:||||::|:.|:|:|||..|:||.|:::||:|..:|
 Frog   351 MTKEEDQQNVLEDIAHRCTSNDLKCIIRLIKHDLKMNSGAKHVLDALDPNAYDAFKASRNLGDVV 415

  Fly   223 EQFATKENKNYASSPVKKTKKTSSSAIQVMTPISPMLASPCKSVEDAFKKSPTGLYSEIKYDGER 287
            |:....|.:      ....|:|.|....:|||:.||||..|||:|.|.||.|.|:|:||||||||
 Frog   416 ERVLRNEQQ------APGMKRTLSVQASLMTPVQPMLAEACKSIEYAMKKCPNGMYAEIKYDGER 474

  Fly   288 VQIHKQGNDFKFFSRNLKPVVDHKIRALKKYIPQAFPGGGEMILDSEIILVDTDTGALLPFGSLG 352
            ||:||.|:.|.:|||:||||:.||:...|.:||:|||||..||||:|::|:||:||..||||:||
 Frog   475 VQVHKNGDHFSYFSRSLKPVLPHKVAHFKDFIPKAFPGGNSMILDAEVLLIDTNTGKPLPFGTLG 539

  Fly   353 AHKKQTFANAAVCLFVFDCILYDGEDLTQLPFRKRREILEQNIQPIKSHVQLSESEFLKTTRELA 417
            .|||..|.:|.|||||||||.::|..|...|..:||:.:..|:..|.:|:..||.:.:....:||
 Frog   540 VHKKAAFKDANVCLFVFDCIYFNGVSLMDRPLSERRKFMRDNMVEIPNHILFSEMKHVTKASDLA 604

  Fly   418 AMTARVLHANLEGVVLKSPTSTYQPGKRNWLKVKKDYLFDGKMADTADLVVLGAWYGSGKKGGTL 482
            .|..||:...|||:|||...|.|:||||:|||||||||.:|.|||||||.||||:||.|..||.:
 Frog   605 DMITRVIREGLEGLVLKDLKSNYEPGKRHWLKVKKDYLNEGAMADTADLAVLGAYYGKGANGGIM 669

  Fly   483 SIFLMGCYDAFGRLWKTVTKVHSGLDDATNAEVHKSLIKLTERADANAIPSWLLCSKSLVPDVLA 547
            |||||||||...:.|.||||..||.||||...:.|.|..:....|.:.|||||..:|:..||.:.
 Frog   670 SIFLMGCYDPESQKWCTVTKCSSGYDDATLQRLQKELNMVKISKDPSKIPSWLKINKNYFPDFII 734

  Fly   548 KDPMKMPVWEITGAEFTKSDAHTASGISVRFPRITRRRSDKSAKEANDLAHLEDLFEAS--KSNV 610
            .||.|.|:|||||||::|::||||:|:|:||||.||.|.||..|.|..|..|::|:..|  ||:.
 Frog   735 HDPKKAPIWEITGAEYSKAEAHTAAGLSIRFPRCTRFRDDKDWKTATTLQQLKELYRLSKEKSDF 799

  Fly   611 NVDLLLANCSKDETAMNNKTTPEKEKKLNGNQSNGSKKLKRSNTGSDDEDGAPVLSKRKESKAIR 675
            |:   .|..|:||...:..::.|.|.  |..|:.....:|:|........|     |.|.|::.:
 Frog   800 NI---TATSSQDEDGSSESSSRENEG--NSRQTASGSMVKKSKNAPSKSPG-----KDKTSESTK 854

  Fly   676 SLSPSQKGLKDFF-----KPSKEFKSVVKKEPKEDE---GNIESTSSKP-------QLFEGLVAH 725
             |.|.||  |:..     :.|:..|:|..|:.|..|   .|..|.:..|       .:|.|:..|
 Frog   855 -LPPPQK--KEELPKAEKRKSQTPKTVQSKKAKISETGHSNGHSIAQSPVTNKTLLDIFTGVKLH 916

  Fly   726 FAMEKDS-SKLMQQFSQHGGCCTTEPQKADLVFYANTNEALDLEKLRTLYRR------SCRHLNV 783
            .....|. :||.:.|....|         |||      ...||.....:..|      ..:|:..
 Frog   917 IPSTLDDFAKLRRYFIAFDG---------DLV------PEYDLPTATHVMGREPECIADAKHVTP 966

  Fly   784 SWLQSCL 790
            .|:..|:
 Frog   967 HWIWECI 973

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DNAlig3NP_650187.2 DNA_ligase_A_N 36..200 CDD:282522 74/164 (45%)
dnl1 88..604 CDD:273147 263/516 (51%)
Adenylation_DNA_ligase_III 242..454 CDD:185712 115/212 (54%)
OBF_DNA_ligase_III 460..598 CDD:153436 77/138 (56%)
lig3XP_012827218.1 zf-PARP 64..145 CDD:279039
DNA_ligase_A_N 228..393 CDD:282522 74/166 (45%)
dnl1 282..791 CDD:273147 263/516 (51%)
Adenylation_DNA_ligase_III 429..641 CDD:185712 115/212 (54%)
OBF_DNA_ligase_III 647..785 CDD:153436 77/138 (56%)
LIG3_BRCT 905..977 CDD:293364 17/85 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C322368616
eggNOG 1 0.900 E1_COG1793
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H32109
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D189866at33208
OrthoFinder 1 1.000 FOG0007850
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.710

Return to query results.
Submit another query.