DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DNAlig3 and LIG4

Sequence 1:NP_650187.2 Gene:DNAlig3 FlyBaseID:FBgn0286075 Length:806 Species:Drosophila melanogaster
Sequence 2:NP_001339533.1 Gene:LIG4 HGNCID:6601 Length:923 Species:Homo sapiens

Alignment Length:809 Identity:190/810 (23%)
Similarity:326/810 (40%) Gaps:154/810 (19%)


  Fly    52 KAERLQRFFEKGSSGKGF--------KGDTVLW---VQFLIPAANQR--VYNLQNKALIKLFSRI 103
            :||:::.|.|...|.:.|        |..|..:   ::.::|...:.  .|.::...|.||:..:
Human    44 RAEKIRHFREFLDSWRKFHDALHKNHKDVTDSFYPAMRLILPQLERERMAYGIKETMLAKLYIEL 108

  Fly   104 FNADQQQMHLDLEQDGDVSETLRKH------------FA--ASKKLKPQ--KQSKLYLQEVEEML 152
            .|         |.:||..:..|..:            ||  |...|||:  ::..|.:|:|.: |
Human   109 LN---------LPRDGKDALKLLNYRTPTGTHGDAGDFAMIAYFVLKPRCLQKGSLTIQQVND-L 163

  Fly   153 LHLVERTKEDEQTDLLQK----LCSKATDLDLRTFIRLVKHDLRINARARHILDAFGPDAYPAYQ 213
            |..:......::.||::|    |.::::.|:.:..||::..||::....:.|...|..||...:.
Human   164 LDSIASNNSAKRKDLIKKSLLQLITQSSALEQKWLIRMIIKDLKLGVSQQTIFSVFHNDAAELHN 228

  Fly   214 SSRDLVAIVEQFATKENKNYASSPVKKTKKTSSSAIQVMTPISPMLA--SPCKSVEDAFKKSPTG 276
            .:.||..:..|.         ..|   :...|..:|.:.:...||||  :..:.:|...|..  .
Human   229 VTTDLEKVCRQL---------HDP---SVGLSDISITLFSAFKPMLAAIADIEHIEKDMKHQ--S 279

  Fly   277 LYSEIKYDGERVQIHKQGNDFKFFSRNLKPVVDH-----KIRALKKYIPQAFPGGGEM-ILDSEI 335
            .|.|.|.||||:|:||.|:.:|:||||.....|.     ...:|..:|..||....:: |||.|:
Human   280 FYIETKLDGERMQMHKDGDVYKYFSRNGYNYTDQFGASPTEGSLTPFIHNAFKADIQICILDGEM 344

  Fly   336 ILVDTDTGALLPFGSLGAHKKQT-FANAAVCLFVFDCILYDGEDLTQLPFRKRREILEQNIQPIK 399
            :..:.:|...:..|:....|:.. .::...|..|||.::.:.:.|.....|||.|||.....||.
Human   345 MAYNPNTQTFMQKGTKFDIKRMVEDSDLQTCYCVFDVLMVNNKKLGHETLRKRYEILSSIFTPIP 409

  Fly   400 SHVQLSESEFLKTTRELAAMTARVLHANLEGVVLKSPTSTYQPGKR--NWLKVKKDYLFDGKMAD 462
            ..:::.:.....|..|:.......:....||:::|.|.|.|:|.||  .|||:|.:|: .|.| |
Human   410 GRIEIVQKTQAHTKNEVIDALNEAIDKREEGIMVKQPLSIYKPDKRGEGWLKIKPEYV-SGLM-D 472

  Fly   463 TADLVVLGAWYGSGKKGGTLSIFLMGCYD-----AFGRLWKTVTKVHSGLDDATNAEVHKSLIKL 522
            ..|::::|.::|.|.:||.:|.||....:     ....::.|:::|.||.......::...|.|.
Human   473 ELDILIVGGYWGKGSRGGMMSHFLCAVAEKPPPGEKPSVFHTLSRVGSGCTMKELYDLGLKLAKY 537

  Fly   523 TERADANAIPSWLLCSKSLVPDVLAKDPMKMPVWEITGAEFTKSDAHTASGISVRFPRITRRRSD 587
            .:.....|.||.:||... .|:|.. :|....:.:|..||...||.: .:|.::|||||.:.|.|
Human   538 WKPFHRKAPPSSILCGTE-KPEVYI-EPCNSVIVQIKAAEIVPSDMY-KTGCTLRFPRIEKIRDD 599

  Fly   588 KSAKEANDLAHLEDLFEASKSNVNVDLLLANCSKDETAMNNKTTPEKEKKLNGNQSNGSKKLKRS 652
            |...|...|..||.|                                     ..:::|....|..
Human   600 KEWHECMTLDDLEQL-------------------------------------RGKASGKLASKHL 627

  Fly   653 NTGSDDEDGAPVLSKRKESKAIRSLSPSQKGLKDFFKPSKEFKSVVKKEPKEDEGNIESTSSKPQ 717
            ..|.|||   |...|||.:..::.:.    |:.:..|..                |:.:.:....
Human   628 YIGGDDE---PQEKKRKAAPKMKKVI----GIIEHLKAP----------------NLTNVNKISN 669

  Fly   718 LFEGLVAHFAMEKDSS---KLMQQFSQHGGCCTTEPQKADLVFYANTNEALDLEKLRTL-YRRSC 778
            :||.:........||.   .|..:.::.||.....|........|.:      |.:|.. ...|.
Human   670 IFEDVEFCVMSGTDSQPKPDLENRIAEFGGYIVQNPGPDTYCVIAGS------ENIRVKNIILSN 728

  Fly   779 RH--LNVSWLQSCLDTQSRQP----FPLH 801
            :|  :..:||..|..|:|..|    |.:|
Human   729 KHDVVKPAWLLECFKTKSFVPWQPRFMIH 757

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DNAlig3NP_650187.2 DNA_ligase_A_N 36..200 CDD:282522 38/181 (21%)
dnl1 88..604 CDD:273147 147/552 (27%)
Adenylation_DNA_ligase_III 242..454 CDD:185712 64/223 (29%)
OBF_DNA_ligase_III 460..598 CDD:153436 41/143 (29%)
LIG4NP_001339533.1 dnl1 93..614 CDD:273147 146/550 (27%)
BRCT 668..742 CDD:306918 16/80 (20%)
DNA_ligase_IV 762..795 CDD:314367
BRCT 841..910 CDD:306918
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D189866at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.