DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DNAlig3 and LIG3

Sequence 1:NP_650187.2 Gene:DNAlig3 FlyBaseID:FBgn0286075 Length:806 Species:Drosophila melanogaster
Sequence 2:XP_005258027.1 Gene:LIG3 HGNCID:6600 Length:1018 Species:Homo sapiens

Alignment Length:776 Identity:334/777 (43%)
Similarity:454/777 (58%) Gaps:46/777 (6%)


  Fly    28 NEDNKLDTFRRICDEIAGESSYLKKAERLQRFFEKGSSGKGFKGDTVLWVQFLIPAANQRVYNLQ 92
            ::|..|..||::|..:|...||..|.:.:|.|..|||:|.||.||..|.|:.|:|...:.||||.
Human   267 HKDCLLREFRKLCAMVADNPSYNTKTQIIQDFLRKGSAGDGFHGDVYLTVKLLLPGVIKTVYNLN 331

  Fly    93 NKALIKLFSRIFNADQQQMHLDLEQDGDVSETLRKHFAASKKLKPQKQSKLYLQEVEEMLLHLVE 157
            :|.::||||||||.:...|..|||| ||||||:|..|..||...|..:|.|.:|||:|.||.|.:
Human   332 DKQIVKLFSRIFNCNPDDMARDLEQ-GDVSETIRVFFEQSKSFPPAAKSLLTIQEVDEFLLRLSK 395

  Fly   158 RTKEDEQTDLLQKLCSKATDLDLRTFIRLVKHDLRINARARHILDAFGPDAYPAYQSSRDLVAIV 222
            .||||||...||.:.|:.|..||:..|||:||||::|:.|:|:|||..|:||.|:::||:|..:|
Human   396 LTKEDEQQQALQDIASRCTANDLKCIIRLIKHDLKMNSGAKHVLDALDPNAYEAFKASRNLQDVV 460

  Fly   223 EQFATKENKNYASSPVKK---TKKTSSSAIQVMTPISPMLASPCKSVEDAFKKSPTGLYSEIKYD 284
            |:..      :.:..|:|   .::..|....:|||:.||||..|||||.|.||.|.|::||||||
Human   461 ERVL------HNAQEVEKEPGQRRALSVQASLMTPVQPMLAEACKSVEYAMKKCPNGMFSEIKYD 519

  Fly   285 GERVQIHKQGNDFKFFSRNLKPVVDHKIRALKKYIPQAFPGGGEMILDSEIILVDTDTGALLPFG 349
            |||||:||.|:.|.:|||:||||:.||:...|.|||||||||..||||||::|:|..||..||||
Human   520 GERVQVHKNGDHFSYFSRSLKPVLPHKVAHFKDYIPQAFPGGHSMILDSEVLLIDNKTGKPLPFG 584

  Fly   350 SLGAHKKQTFANAAVCLFVFDCILYDGEDLTQLPFRKRREILEQNIQPIKSHVQLSESEFLKTTR 414
            :||.|||..|.:|.|||||||||.::...|...|..:||:.|..|:..|.:.:..||.:.:....
Human   585 TLGVHKKAAFQDANVCLFVFDCIYFNDVSLMDRPLCERRKFLHDNMVEIPNRIMFSEMKRVTKAL 649

  Fly   415 ELAAMTARVLHANLEGVVLKSPTSTYQPGKRNWLKVKKDYLFDGKMADTADLVVLGAWYGSGKKG 479
            :||.|..||:...|||:|||....||:||||:|||||||||.:|.||||||||||||:||.|.||
Human   650 DLADMITRVIQEGLEGLVLKDVKGTYEPGKRHWLKVKKDYLNEGAMADTADLVVLGAFYGQGSKG 714

  Fly   480 GTLSIFLMGCYDAFGRLWKTVTKVHSGLDDATNAEVHKSLIKLTERADANAIPSWLLCSKSLVPD 544
            |.:|||||||||...:.|.||||...|.||||.|.:...|..:....|.:.|||||..:|...||
Human   715 GMMSIFLMGCYDPGSQKWCTVTKCAGGHDDATLARLQNELDMVKISKDPSKIPSWLKVNKIYYPD 779

  Fly   545 VLAKDPMKMPVWEITGAEFTKSDAHTASGISVRFPRITRRRSDKSAKEANDLAHLEDLFEASKSN 609
            .:..||.|..|||||||||:||:||||.|||:||||.||.|.||..|.|.:|..|::|::.||..
Human   780 FIVPDPKKAAVWEITGAEFSKSEAHTADGISIRFPRCTRIRDDKDWKSATNLPQLKELYQLSKEK 844

  Fly   610 VNVDLLLANCSKDETAMNNKTTPEKEKKLNGN---------QSNGSKKLKRSNTGSDDEDGAPVL 665
            .:..::    :.||.:.....:.|:.|..:|:         .|..:||.:...:.|:.:||....
Human   845 ADFTVV----AGDEGSSTTGGSSEENKGPSGSAVSRKAPSKPSASTKKAEGKLSNSNSKDGNMQT 905

  Fly   666 SKRKESKAIRSLSPSQKGLKDFFKPSKEFKSVVKKEPKEDEGNIESTSSKPQLFEGLVAHF-AME 729
            :|....|....|:.....:|           |.:|....|| .:..|.....:|.|:..:. ...
Human   906 AKPSAMKVGEKLATKSSPVK-----------VGEKRKAADE-TLCQTKVLLDIFTGVRLYLPPST 958

  Fly   730 KDSSKLMQQFSQHGGCCTTEPQKADLVFYANTNEALDLEKLRTLYRRSCRHLNVSWLQSCL 790
            .|.|:|.:.|....|         |||...:...|..:...|. ...:.:.::..|:.:|:
Human   959 PDFSRLRRYFVAFDG---------DLVQEFDMTSATHVLGSRD-KNPAAQQVSPEWIWACI 1009

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DNAlig3NP_650187.2 DNA_ligase_A_N 36..200 CDD:282522 81/164 (49%)
dnl1 88..604 CDD:273147 275/519 (53%)
Adenylation_DNA_ligase_III 242..454 CDD:185712 115/212 (54%)
OBF_DNA_ligase_III 460..598 CDD:153436 81/138 (59%)
LIG3XP_005258027.1 zf-PARP 106..188 CDD:279039
DNA_ligase_A_N 273..438 CDD:282522 81/166 (49%)
dnl1 327..839 CDD:273147 275/519 (53%)
Adenylation_DNA_ligase_III 477..689 CDD:185712 115/212 (54%)
OBF_DNA_ligase_III 695..833 CDD:153436 81/138 (59%)
LIG3_BRCT 942..1013 CDD:293364 14/79 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C322368381
eggNOG 1 0.900 E1_COG1793
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H32109
Inparanoid 1 1.050 584 1.000 Inparanoid score I998
Isobase 1 0.950 0 Normalized mean entropy S3614
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D189866at33208
OrthoFinder 1 1.000 FOG0007850
OrthoInspector 1 1.000 T1074063
orthoMCL 1 0.900 OOG5_134498
Panther 1 1.100 LDO PTHR45674
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3850
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1312.740

Return to query results.
Submit another query.