DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DNAlig3 and DNAlig4

Sequence 1:NP_650187.2 Gene:DNAlig3 FlyBaseID:FBgn0286075 Length:806 Species:Drosophila melanogaster
Sequence 2:NP_572907.1 Gene:DNAlig4 FlyBaseID:FBgn0030506 Length:918 Species:Drosophila melanogaster

Alignment Length:856 Identity:204/857 (24%)
Similarity:334/857 (39%) Gaps:228/857 (27%)


  Fly    36 FRRIC---DEIAGESSYLKKAERLQRFFEKGSSGK-GFKGDTVL--------------WVQFLIP 82
            ||.||   ::|........|.|.|:.::|.....: .|:..|.|              .::.|:|
  Fly    11 FRDICSLFEKIKATQKVANKEEVLKSYYESFCRHRESFRRQTGLNNDQPEDGASSFYSVLRLLLP 75

  Fly    83 AAN--QRVYNLQNKALIKLFSRIF-----NADQ---QQMHLDLEQD-GDVSETLRKHFAASKKLK 136
            .|:  :..|.||..||.:|:.|:.     ::|.   |..:.::.:| |||..::         ||
  Fly    76 GADTGRDTYGLQITALGRLYIRVLQLPTDSSDAIRLQHRNGNMYRDYGDVVYSV---------LK 131

  Fly   137 PQ---KQSKLYLQEVEEMLLHLVERTKEDEQTDLLQKLCSKATDLDLRTFIRLVKHDLRINARAR 198
            |:   ..|.|.|:|:.:||..:.....|.:|..|: :...:|:..:.:..|||:...|.:....:
  Fly   132 PRCFNPPSNLRLKEIHQMLDTIANEDTEVKQQQLI-RFTEQASPEEQKWLIRLLLKSLGLGIGEQ 195

  Fly   199 HILDAFGPDAYPAYQSSRDLVAIVEQFATKENKNYASSPVKKTKKTSSSAIQ------VMTP--- 254
            .|.....|.|...||...||..:....|.:.....|||     .|.|.:|::      |:.|   
  Fly   196 KIFGVLHPKAQDIYQRCSDLGHVCNLLADRTTDLDASS-----SKDSKAAVKFVNLNSVIRPFHQ 255

  Fly   255 ISPMLASPCK----SVEDAFKKSPTGLYSEIKYDGERVQIHKQGNDFKF-------FSRNLKPVV 308
            |.|||   |:    .:::..:...  ||.|.|.||||.|:|.....|.:       ::||.....
  Fly   256 IRPML---CERFPGDIQELMQSDV--LYLETKMDGERFQLHIDRGRFMYISRNGVDYTRNFGHSY 315

  Fly   309 DH-----KIRALKKYIPQAFPGGGE-MILDSEIILVD------------TDTGALLPFGSLGAHK 355
            ||     |:|.|       .|.|.| :|||.|:::.|            ||..:|.|.||.    
  Fly   316 DHGTLTPKLRGL-------LPLGLESIILDGEMMVWDTNKLRFREKGENTDVKSLKPEGSW---- 369

  Fly   356 KQTFANAAVCLFVFDCILYDGEDLTQLPFRKRREILEQNIQPIKSHVQLSESEFLKTTRELAAMT 420
                   ..|..|:|.:.::|:.|....:.:|...|::.|......:||..:..:.:.:|...:.
  Fly   370 -------QPCFVVYDLLYFNGQSLLDHTYIQRAYKLQKLIVEQSGVLQLMRARKIGSVQEFNELF 427

  Fly   421 ARVLHANLEGVVLKSPTSTYQPGKR---NWLKVKKDYLFDGKMADTADLVVLGAWYGSGKKGGTL 482
            .:.|.::.||:|||...|.||||.|   .|.|.|.||: .|.:.: .|::::||:|  .:|...:
  Fly   428 QQALDSHAEGIVLKKQGSRYQPGVRLGGGWYKDKADYI-KGLITE-FDVLIIGAFY--NRKRTFV 488

  Fly   483 SIFLMGCYD-------------AFGRLWKTVTKVHSGLDDATNAEVHKSL---------IKLTER 525
            ..||:|...             :.|.:... ||....|:.......|..:         .|..||
  Fly   489 DSFLLGVLQPAPPGSSNRPEVFSIGVVANN-TKQRGVLNHTLKPHWHDVVNEPPPLWFHYKPKER 552

  Fly   526 ADANAIPSWLLCSKSLVPDVLAKD--PMKMPVWEITGAEFTKSDAHTASGISVRFPRITRRRSDK 588
            :....:  |:....|::..|.|.|  |        .||.||:...|        |||...:|.||
  Fly   553 SGCPDL--WIEPQNSVILQVKAADLAP--------NGAFFTRKSLH--------FPRTEMKRDDK 599

  Fly   589 SAKEANDLAHLEDLFEASKSNVNVDLLLANCSKDETAMNNKTTPEKEKKLNGNQSNGSKKLKRSN 653
            :..|...|....||                |.          .|...||||      .::|:.  
  Fly   600 TWSECMTLKEFNDL----------------CG----------GPLAIKKLN------KRQLRL-- 630

  Fly   654 TGSDDEDGAPVLSKRKESKAIRSLSPSQK---GLKDFFKPSKEFKSVVKKEPKEDEGNIESTSSK 715
                 ||   |.:|||:.:    ::||::   ||..:             |.:.|.....|||  
  Fly   631 -----ED---VTTKRKQMR----MTPSERSRLGLAVY-------------EKRYDASTSASTS-- 668

  Fly   716 PQLFEGL---VAHFAMEKDSSKLMQQFS-QHGGCCTTEPQKAD-LVFYANTNEALDLEKLRTLYR 775
             :||:||   :...:..:.|...:|:.: ::|||....|...| ..|....:|...:::|.....
  Fly   669 -KLFDGLSFCILSGSAGRHSKHQLQELAVKNGGCIVENPLPNDPKCFCIAGDETFLVKRLILQQP 732

  Fly   776 RSCRHLNVSWL 786
            |:|..:.:.||
  Fly   733 RTCDIVRMEWL 743

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DNAlig3NP_650187.2 DNA_ligase_A_N 36..200 CDD:282522 45/196 (23%)
dnl1 88..604 CDD:273147 149/593 (25%)
Adenylation_DNA_ligase_III 242..454 CDD:185712 69/253 (27%)
OBF_DNA_ligase_III 460..598 CDD:153436 35/162 (22%)
DNAlig4NP_572907.1 DNA_ligase_A_N 10..197 CDD:282522 45/196 (23%)
dnl1 84..613 CDD:273147 148/590 (25%)
Adenylation_DNA_ligase_IV 249..466 CDD:185713 67/241 (28%)
OBF_DNA_ligase_IV 469..607 CDD:153437 34/160 (21%)
BRCT 668..745 CDD:214602 19/80 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C105314841
eggNOG 1 0.900 E1_COG1793
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D189866at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.