DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DNAlig3 and Lig4

Sequence 1:NP_650187.2 Gene:DNAlig3 FlyBaseID:FBgn0286075 Length:806 Species:Drosophila melanogaster
Sequence 2:NP_795927.2 Gene:Lig4 MGIID:1335098 Length:911 Species:Mus musculus

Alignment Length:857 Identity:195/858 (23%)
Similarity:327/858 (38%) Gaps:218/858 (25%)


  Fly    36 FRRICDEIAGESSYLKKAERLQRFFEKGSSGKGFKGDTVLWVQF--------------------- 79
            |..:|..:          ||:|:..::....:.||.....|.:|                     
Mouse    16 FADLCSTL----------ERIQKGKDRAEKIRHFKEFLDSWRKFHDALHKNRKDVTDSFYPAMRL 70

  Fly    80 LIPAANQR--VYNLQNKALIKLFSRIFNADQQQMHLDLEQDGDVSETLRKH------------FA 130
            ::|...:.  .|.::...|.||:..:.|         |.::|..::.|..:            ||
Mouse    71 ILPQLERERMAYGIKETMLAKLYIELLN---------LPREGKDAQKLLNYRTPSGARTDAGDFA 126

  Fly   131 --ASKKLKPQ--KQSKLYLQEVEEMLLHLVERTKEDEQTDLLQK----LCSKATDLDLRTFIRLV 187
              |...|||:  ::..|.:|:|.| ||.||......::.||::|    |.::::.|:.:..||::
Mouse   127 MIAYFVLKPRCLQKGSLTIQQVNE-LLDLVASNNSGKKKDLVKKSLLQLITQSSALEQKWLIRMI 190

  Fly   188 KHDLRINARARHILDAFGPDAYPAYQSSRDLVAIVEQFATKENKNYASSPVKKTKKTSSSAIQVM 252
            ..||::....:.|...|..||...:..:.||..:..|.         ..|   :...|..:|.:.
Mouse   191 IKDLKLGISQQTIFSIFHNDAVELHNVTTDLEKVCRQL---------HDP---SVGLSDISITLF 243

  Fly   253 TPISPMLA--SPCKSVEDAFKKSPTGLYSEIKYDGERVQIHKQGNDFKFFSRNLKPVVDH----- 310
            :...||||  :..:.||...|:.  ..|.|.|.||||:|:||.|..:::||||.....|.     
Mouse   244 SAFKPMLAAVADVERVEKDMKQQ--SFYIETKLDGERMQMHKDGALYRYFSRNGYNYTDQFGESP 306

  Fly   311 KIRALKKYIPQAFPGGGEM---ILDSEIILVDTDTGALLPFGSLGAHKKQTFANAAV-------- 364
            :..:|..:|..||  |.::   |||.|::..:..|              |||....|        
Mouse   307 QEGSLTPFIHNAF--GTDVQACILDGEMMAYNPTT--------------QTFMQKGVKFDIKRMV 355

  Fly   365 -------CLFVFDCILYDGEDLTQLPFRKRREILEQNIQPIKSHVQLSESEFLKTTRELAAMTAR 422
                   |..|||.::.:.:.|.:...|||.|||.....||:..:::.:.....|.:|:......
Mouse   356 EDSGLQTCYSVFDVLMVNKKKLGRETLRKRYEILSSTFTPIQGRIEIVQKTQAHTKKEVVDALND 420

  Fly   423 VLHANLEGVVLKSPTSTYQPGKR--NWLKVKKDYLFDGKMADTADLVVLGAWYGSGKKGGTLSIF 485
            .:....||:::|.|.|.|:|.||  .|||:|.:|: .|.| |..|::::|.::|.|.:||.:|.|
Mouse   421 AIDKREEGIMVKHPLSIYKPDKRGEGWLKIKPEYV-SGLM-DELDVLIVGGYWGKGSRGGMMSHF 483

  Fly   486 LMGCYDA-----FGRLWKTVTKVHSGLDDATNAEVHKSLIKLTERADANAIPSWLLCSKSLVPDV 545
            |....:.     ...::.|:.:|.||.......::...|.|..:.....:.||.:||... .|:|
Mouse   484 LCAVAETPPPGDRPSVFHTLCRVGSGYTMKELYDLGLKLAKYWKPFHKKSPPSSILCGTE-KPEV 547

  Fly   546 LAKDPMKMPVWEITGAEFTKSDAHTASGISVRFPRITRRRSDKSAKEANDLAHLEDLFEASKSNV 610
            .. :|....:.:|..||...||.: .:|.::|||||.:.|.||...|...|..||.|        
Mouse   548 YI-EPQNSVIVQIKAAEIVPSDMY-KTGSTLRFPRIEKIRDDKEWHECMTLGDLEQL-------- 602

  Fly   611 NVDLLLANCSKDETAMNNKTTPEKEKKLNGNQSNGSKKLKRSNTGSDDEDGAPVLSKRKESKAIR 675
                                         ..:::|....|..:.|.|||                
Mouse   603 -----------------------------RGKASGKLATKHLHVGDDDE---------------- 622

  Fly   676 SLSPSQKGLKDFFKPSKEFKSVVK-KEPKEDEGNIESTSSKPQLFE--------GLVAHFAMEKD 731
               |.:|..|...|..|..:.:.. |.|     |:.:.:....:||        ||..:     .
Mouse   623 ---PREKRRKPISKTKKAIRIIEHLKAP-----NLSNVNKVSNVFEDVEFCVMSGLDGY-----P 674

  Fly   732 SSKLMQQFSQHGGCCTTEPQKADLVFYANTNEALDLEKLRTLYRRSCRHLNV---SWLQSCLDTQ 793
            .:.|..:.::.||.....|........|.:      |.:|.....|....:|   .||..|..|:
Mouse   675 KADLENRIAEFGGYIVQNPGPDTYCVIAGS------ENVRVKNIISSDKNDVVKPEWLLECFKTK 733

  Fly   794 SRQP----FPLH 801
            :..|    |.:|
Mouse   734 TCVPWQPRFMIH 745

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DNAlig3NP_650187.2 DNA_ligase_A_N 36..200 CDD:282522 41/207 (20%)
dnl1 88..604 CDD:273147 151/568 (27%)
Adenylation_DNA_ligase_III 242..454 CDD:185712 67/239 (28%)
OBF_DNA_ligase_III 460..598 CDD:153436 40/143 (28%)
Lig4NP_795927.2 DNA_ligase_A_N 15..203 CDD:282522 41/207 (20%)
dnl1 81..602 CDD:273147 150/566 (27%)
Adenylation_DNA_ligase_IV 235..455 CDD:185713 68/238 (29%)
OBF_DNA_ligase_IV 459..596 CDD:153437 39/141 (28%)
BRCT 656..730 CDD:214602 16/85 (19%)
DNA_ligase_IV 750..782 CDD:288294
BRCT 830..899 CDD:237994
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1793
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D274264at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.