DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DNAlig3 and Lig3

Sequence 1:NP_650187.2 Gene:DNAlig3 FlyBaseID:FBgn0286075 Length:806 Species:Drosophila melanogaster
Sequence 2:XP_006247051.1 Gene:Lig3 RGDID:1309875 Length:1002 Species:Rattus norvegicus

Alignment Length:790 Identity:337/791 (43%)
Similarity:460/791 (58%) Gaps:58/791 (7%)


  Fly    14 TRLLCNKMASKGLHNEDNKLDTFRRICDEIAGESSYLKKAERLQRFFEKGSSGKGFKGDTVLWVQ 78
            |.|..:|...|   ::|..|..||::|..:|...||..|.:.:..|.:|||:|.||:||..|.|:
  Rat   249 TSLSASKCDPK---HKDCLLREFRKLCAMVAENPSYNTKTQIIHDFLQKGSTGDGFRGDVYLTVK 310

  Fly    79 FLIPAANQRVYNLQNKALIKLFSRIFNADQQQMHLDLEQDGDVSETLRKHFAASKKLKPQKQSKL 143
            .|:|...:.||||.:|.::||||||||.:...|..|||| ||||||:|..|..||...|..:|.|
  Rat   311 LLLPGVIKSVYNLNDKQIVKLFSRIFNCNPDDMARDLEQ-GDVSETIRVFFEQSKSFPPAAKSLL 374

  Fly   144 YLQEVEEMLLHLVERTKEDEQTDLLQKLCSKATDLDLRTFIRLVKHDLRINARARHILDAFGPDA 208
            .:|||:..||||.:.||||||...||.:.|:.|..||:..|||:||||::|:.|:|:|||..|:|
  Rat   375 TIQEVDAFLLHLSKLTKEDEQQQALQDIASRCTANDLKCIIRLIKHDLKMNSGAKHVLDALDPNA 439

  Fly   209 YPAYQSSRDLVAIVEQFATKENKNYASSPVKK---TKKTSSSAIQVMTPISPMLASPCKSVEDAF 270
            |.|:::||:|..:||:....|.:      |:|   .::..|....:|||:.||||..|||:|.|.
  Rat   440 YEAFKASRNLQDVVERVLHNEQE------VEKDPGRRRALSVQASLMTPVQPMLAEACKSIEYAM 498

  Fly   271 KKSPTGLYSEIKYDGERVQIHKQGNDFKFFSRNLKPVVDHKIRALKKYIPQAFPGGGEMILDSEI 335
            ||.|.|::|||||||||||:||:|:.|.:|||:||||:.||:...|.|||:|||||..||||||:
  Rat   499 KKCPNGMFSEIKYDGERVQVHKKGDHFSYFSRSLKPVLPHKVAHFKDYIPKAFPGGQSMILDSEV 563

  Fly   336 ILVDTDTGALLPFGSLGAHKKQTFANAAVCLFVFDCILYDGEDLTQLPFRKRREILEQNIQPIKS 400
            :|:|.:||..||||:||.|||..|.:|.|||||||||.::...|...|..:||:.|..|:..|::
  Rat   564 LLIDNNTGKPLPFGTLGVHKKAAFQDANVCLFVFDCIYFNDVSLMDRPLCERRKFLHDNMVEIRN 628

  Fly   401 HVQLSESEFLKTTRELAAMTARVLHANLEGVVLKSPTSTYQPGKRNWLKVKKDYLFDGKMADTAD 465
            .:..||.:.:....:||.|..||:...|||:|||....||:||||:|||||||||.:|.||||||
  Rat   629 RIMFSEMKQVTKASDLADMINRVIREGLEGLVLKDVKGTYEPGKRHWLKVKKDYLNEGAMADTAD 693

  Fly   466 LVVLGAWYGSGKKGGTLSIFLMGCYDAFGRLWKTVTKVHSGLDDATNAEVHKSLIKLTERADANA 530
            ||||||:||.|.|||.:|||||||||...:.|.||||...|.||||.|.:.|.|..:....|.:.
  Rat   694 LVVLGAFYGQGSKGGMMSIFLMGCYDPDSQKWCTVTKCAGGHDDATLARLQKELDMVKISKDPSK 758

  Fly   531 IPSWLLCSKSLVPDVLAKDPMKMPVWEITGAEFTKSDAHTASGISVRFPRITRRRSDKSAKEAND 595
            |||||..:|...||.:..||.|..|||||||||::|:||||.|||:||||.||.|.||..|.|.:
  Rat   759 IPSWLKINKIYYPDFIVPDPKKAAVWEITGAEFSRSEAHTADGISIRFPRCTRIRDDKDWKSATN 823

  Fly   596 LAHLEDLFEASKSNVNVDLLLANCSKDETAMNN--------KTTPEKEKKLNGNQSNGSKKLKRS 652
            |..|::|::.||...:..::..:.....|..:|        .|.|.|..|  |..|..|...|::
  Rat   824 LPQLKELYQLSKDKADFAVVAGDEGSSTTGGSNGENEGTAGSTVPRKGPK--GPPSKSSASAKKT 886

  Fly   653 NTGSDDEDGAPVLSKRKESKAIRSLSPSQKGLKDFFKPSKEFKSVVKKEPKEDEGNIESTSSKPQ 717
            ....:|..     |:..|..|::| ||.:.|:|             :|...|..|   .|.:...
  Rat   887 EQKLNDPS-----SRGGEKLAVKS-SPVKVGMK-------------RKAADETPG---LTKALLD 929

  Fly   718 LFEGLVAHF-AMEKDSSKLMQQFSQHGGCCTTEPQKADLV-FYANTNEALDLEKLRTLYRRSCRH 780
            :|.|:..:. ....|..:|.:.|....|....|...|... ...|.::..|.:.:.:        
  Rat   930 VFTGVRLYLPPSTPDFRRLKRYFVAFNGDLVQEFDMASATHVLGNRDKNTDAQLVSS-------- 986

  Fly   781 LNVSWLQSCL 790
               .|:.:|:
  Rat   987 ---EWIWACI 993

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DNAlig3NP_650187.2 DNA_ligase_A_N 36..200 CDD:282522 80/164 (49%)
dnl1 88..604 CDD:273147 274/519 (53%)
Adenylation_DNA_ligase_III 242..454 CDD:185712 113/212 (53%)
OBF_DNA_ligase_III 460..598 CDD:153436 81/138 (59%)
Lig3XP_006247051.1 zf-PARP 98..178 CDD:279039
DNA_ligase_A_N 266..431 CDD:282522 80/166 (48%)
dnl1 320..832 CDD:273147 274/519 (53%)
Adenylation_DNA_ligase_III 470..682 CDD:185712 113/212 (53%)
OBF_DNA_ligase_III 688..826 CDD:153436 81/138 (59%)
LIG3_BRCT 927..997 CDD:293364 12/79 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C322365477
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H32109
Inparanoid 1 1.050 589 1.000 Inparanoid score I941
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D189866at33208
OrthoFinder 1 1.000 FOG0007850
OrthoInspector 1 1.000 T1087706
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR45674
Phylome 1 0.910 0.667 Consistency score
TreeFam 00.000 Not matched by this tool.
88.000

Return to query results.
Submit another query.