DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DNAlig3 and Lig4

Sequence 1:NP_650187.2 Gene:DNAlig3 FlyBaseID:FBgn0286075 Length:806 Species:Drosophila melanogaster
Sequence 2:NP_001099565.1 Gene:Lig4 RGDID:1304639 Length:911 Species:Rattus norvegicus

Alignment Length:853 Identity:197/854 (23%)
Similarity:333/854 (39%) Gaps:210/854 (25%)


  Fly    36 FRRICDEIAGESSYLKKAERLQRFFEKGSSGKGFKGDTVLWVQF--------------------- 79
            |..:|..:          ||:|:..::....:.||.....|.:|                     
  Rat    16 FADLCSTL----------ERIQKGKDRAEKIRHFKEFLDSWRKFHDALHKNKKDVPDSFYPAMRL 70

  Fly    80 LIPAANQR--VYNLQNKALIKLFSRIFNADQQQMHLDLEQDGDVSETLRKH------------FA 130
            ::|...:.  .|.::...|.||:..:.|         |.::|..::.|..:            ||
  Rat    71 ILPQLERERMAYGIKETMLAKLYIELLN---------LPREGKDAQKLLNYRTPSGARSDAGDFA 126

  Fly   131 --ASKKLKPQ--KQSKLYLQEVEEMLLHLVERTKEDEQTDLLQK----LCSKATDLDLRTFIRLV 187
              |...|||:  ::..|.:|:|.| ||.||......::.||::|    |.::.:.|:.:..||::
  Rat   127 TIAYFVLKPRCLQKGSLTIQKVNE-LLDLVASNNSGKRKDLVKKSLLQLITQCSALEQKWLIRMI 190

  Fly   188 KHDLRINARARHILDAFGPDAYPAYQSSRDLVAIVEQFATKENKNYASSPVKKTKKTSSSAIQVM 252
            ..||::......||..|..||...:..:.||..:..|.         ..|   :...|..:|.:.
  Rat   191 IKDLKLGVSQHTILSIFHNDAVELHNVTTDLEKVCRQL---------HDP---SVGLSDISITLF 243

  Fly   253 TPISPMLA--SPCKSVEDAFKKSPTGLYSEIKYDGERVQIHKQGNDFKFFSRNLKPVVDH----- 310
            :...||||  :..:.||...|:.  ..|.|.|.||||:|:||.|..:::||||.....|.     
  Rat   244 SAFRPMLAAVADVERVEKDMKQQ--SFYIETKLDGERMQMHKDGALYRYFSRNGYNYTDQFGESP 306

  Fly   311 KIRALKKYIPQAFPGGGEM-ILDSEIILVDTDTGALLPFGSLGAHKKQTFANAAV---------- 364
            :..:|..:|..||....:: |||.|::..:..|              |||....|          
  Rat   307 QEGSLTPFIHNAFKTDVQVCILDGEMMAYNPTT--------------QTFMQKGVKFDIKRMVED 357

  Fly   365 -----CLFVFDCILYDGEDLTQLPFRKRREILEQNIQPIKSHVQLSESEFLKTTRELAAMTARVL 424
                 |..|||.::.:.:.|.:...|||.:||.....||:..:::.:....:|.:|:.......:
  Rat   358 SDLQTCYCVFDVLMVNNKKLGRETLRKRYDILSSTFTPIQGRIEIVQKTQAQTKQEVVDALNDAI 422

  Fly   425 HANLEGVVLKSPTSTYQPGKR--NWLKVKKDYLFDGKMADTADLVVLGAWYGSGKKGGTLSIFLM 487
            ....||:::|.|.|.|:|.||  .|||:|.:|: .|.| |..||:::|.::|.|.:||.:|.||.
  Rat   423 DKREEGIMVKHPLSIYKPDKRGEGWLKIKPEYV-TGLM-DELDLLIVGGYWGKGSRGGMMSHFLC 485

  Fly   488 GCYDA-----FGRLWKTVTKVHSGLDDATNAEVHKSLIKLTERADANAIPSWLLCSKSLVPDVLA 547
            ...:.     ...::.|:.:|.||.......::...|.|..:.....:.||.:||... .|:|..
  Rat   486 AVAETPPPGDKPSVFHTLCRVGSGYTMKELYDLGLKLAKYWKPFQRKSPPSCILCGTE-KPEVYI 549

  Fly   548 KDPMKMPVWEITGAEFTKSDAHTASGISVRFPRITRRRSDKSAKEANDLAHLEDLFEASKSNVNV 612
             :|....:.:|..||...||.: .:|.::|||||.:.|.|   ||.:|...|:||          
  Rat   550 -EPQNSVIVQIKAAEIVPSDMY-KTGSTLRFPRIEKIRDD---KEWHDCMTLDDL---------- 599

  Fly   613 DLLLANCSKDETAMNNKTTPEKEKKLNGNQSNGSKKLKRSNTGSDDEDGAPVLSKRKESKAIRSL 677
                                   ::|.| :::|....|..:.|.|||                  
  Rat   600 -----------------------EQLRG-KASGKLATKHLHIGDDDE------------------ 622

  Fly   678 SPSQKGLKDFFKPSKEFKSVVKKEPKEDEGNIESTSSKPQLFE--------GLVAHFAMEKDSSK 734
             |.:|..|...|..|.. .:::.....:..||...|:   :||        ||..:     ....
  Rat   623 -PREKRRKPISKTKKTI-GIIEHLKAPNLSNINKVSN---VFEDVEFCVMSGLDGY-----PKPD 677

  Fly   735 LMQQFSQHGGCCTTEPQKADLVFYANTNEALDLEKLRTLYRRSCRH--LNVSWLQSCLDTQSRQP 797
            |..:.::.||.....|........|.:...    ::|.:. .|.||  :...||..|..|::..|
  Rat   678 LENKIAEFGGYIVQNPGPDTYCVIAGSENI----RVRNII-SSDRHDVVKPEWLLECFKTKTCVP 737

  Fly   798 ----FPLH 801
                |.:|
  Rat   738 WQPRFMIH 745

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DNAlig3NP_650187.2 DNA_ligase_A_N 36..200 CDD:282522 41/207 (20%)
dnl1 88..604 CDD:273147 151/566 (27%)
Adenylation_DNA_ligase_III 242..454 CDD:185712 65/237 (27%)
OBF_DNA_ligase_III 460..598 CDD:153436 41/143 (29%)
Lig4NP_001099565.1 DNA_ligase_A_N 15..203 CDD:282522 41/207 (20%)
dnl1 81..602 CDD:273147 151/600 (25%)
Adenylation_DNA_ligase_IV 235..455 CDD:185713 66/236 (28%)
OBF_DNA_ligase_IV 459..596 CDD:153437 41/144 (28%)
BRCT 654..730 CDD:278934 17/89 (19%)
DNA_ligase_IV 750..782 CDD:288294
BRCT <845..899 CDD:237994
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1793
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D189866at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.