DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DNAlig3 and lig-1

Sequence 1:NP_650187.2 Gene:DNAlig3 FlyBaseID:FBgn0286075 Length:806 Species:Drosophila melanogaster
Sequence 2:NP_741625.2 Gene:lig-1 WormBaseID:WBGene00002985 Length:773 Species:Caenorhabditis elegans

Alignment Length:755 Identity:205/756 (27%)
Similarity:342/756 (45%) Gaps:133/756 (18%)


  Fly    35 TFRRICDEIAGESSYLKKAERLQRFFEKGSSGKGFKGDTV-----LWVQFLIPAANQRVYNLQNK 94
            |..:| :|::|:    ||.:.|.:||.|...   |..|.:     :.|..|.|:.......:...
 Worm    27 TLEKI-EELSGK----KKVDELAQFFTKVLD---FSPDDLTACVYMSVNQLGPSYEGLELGVAEN 83

  Fly    95 ALIKLFSRIFNADQQQMHLDLEQDGDV------SETLRKHFAASKKLK-PQKQSKLYLQEVEEML 152
            :|||..::.....:.::..||...||:      |.:.:|..|..|.|. |...:|  |.|:.:  
 Worm    84 SLIKAVAKATGRTEGKIKEDLRAKGDLGTVAQQSRSNQKMLAVPKALTVPTVFNK--LTEIAK-- 144

  Fly   153 LHLVERTKEDEQTDLLQKLCSKATDLDLRTFIRLVKHDLRINARARHILDAFGPDAYPAYQSSR- 216
              |...:..:::.|.:..|......::.|..:|::...:||....:.:|.|.|    .|:..|: 
 Worm   145 --LSGTSAMNKKVDAISALLIACQGIEARFLVRMLAGKMRIGLGEQSVLSALG----HAFTLSKI 203

  Fly   217 -------DLVAIVEQFATKENKN-YASSP-----------------VKKTKKTSSSAIQVMTPIS 256
                   |.:..::....|..|. |...|                 |:|.|.:..      .|:.
 Worm   204 TDQKVRGDKLDSLKDANVKRVKTAYCECPNYNRLIEVALTEGVEALVEKCKLSPG------IPLK 262

  Fly   257 PMLASPCKSVEDAFK--KSPTGLYSEIKYDGERVQIHKQ--GNDFKFFSRNLK------PVVDHK 311
            ||||.|.|.:::..:  ::.| :..|.||||||.||||:  |..| .:|||.:      |.:..|
 Worm   263 PMLAHPTKGIDEIMRRFRNQT-MTCEWKYDGERGQIHKREDGQIF-IYSRNQENNTTKYPDIIEK 325

  Fly   312 IRALKKYIPQAFPGGG--EMILDSEIILVDTDTGALLPFGSLGAHKKQTFAN---AAVCLFVFDC 371
            |        .:..|.|  ..|:|:|::.:| :.|.:|||..|...|::...:   ..|.:|:||.
 Worm   326 I--------SSCIGDGVTSFIVDAEVVAID-EAGLILPFQVLSTRKRKNATDDNGVKVVVFLFDL 381

  Fly   372 ILYDGEDLTQLPFRKRREILEQNIQPIKSHVQLSESEFLKTTRELAAMTARVLHANLEGVVLKS- 435
            :.::||.|.:.|.|||||:|..|.:.|......:.|.....|.|:.:.....:....||:::|: 
 Worm   382 LYFNGEPLVRKPLRKRRELLRTNFKKIDGSFYFATSVDTNDTDEINSFFDEAVQNKCEGLMIKTL 446

  Fly   436 -PTSTYQPGKR--NWLKVKKDYLFDGKMADTADLVVLGAWYGSGKKGGTLSIFLMGCYDAFGRLW 497
             ..:||:..:|  :|||:||||: || :.||.||||:||:.|.||:.|....:|:|||:.....:
 Worm   447 DTEATYEISRRSHSWLKMKKDYV-DG-VGDTLDLVVMGAYSGVGKRTGVYGGYLLGCYNPTTEEY 509

  Fly   498 KTVTKVHSGLDDATNAEVHKSLIKLTERADANAIPSWLLCSKSLVPDVLAKDPMKMPVWEITGAE 562
            ::|.|:.:|..|...||.:|  |...::.|.:  ||:.....:|.||......:   |:|:..|:
 Worm   510 ESVCKIGTGFTDEDLAEQYK--ILQDKKIDKS--PSYYQFDHTLKPDDTFSPYL---VFEVKCAD 567

  Fly   563 FTKSDAHTAS--------GISVRFPRITRRRSDKSAKEANDLAHLEDLFEASKSNVNVDLLLANC 619
            .|.|..|.|:        |||:||||..|.|.||::.:|.....:.::::..::..|..:..|:.
 Worm   568 ITISPRHKAASGLTDDGKGISLRFPRFLRIRDDKNSDDATSSEQVLEMYKNQEAFANQKIEKADA 632

  Fly   620 SKDETAMNNKTTPEKEKKLNGNQSNGSKKLKRSNTGSDDEDGAPVLSK-RKESKAIRSLSPSQKG 683
            ..::.....|...|:|..:. |.|.||.|..            ||..: :||:.  :|:||.:..
 Worm   633 VDEDDEFEEKEDEEEELNMT-NVSEGSSKEN------------PVKEEIKKETP--KSVSPKKFE 682

  Fly   684 LKDFFKPSKEFKSVVKKEP--KEDE------GNIESTSSK 715
            .|...|.|...||.||..|  ||.|      .:|.|:|:|
 Worm   683 KKPPVKSSPVNKSPVKSSPIKKEAEKKKGPVASIFSSSTK 722

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DNAlig3NP_650187.2 DNA_ligase_A_N 36..200 CDD:282522 37/176 (21%)
dnl1 88..604 CDD:273147 158/576 (27%)
Adenylation_DNA_ligase_III 242..454 CDD:185712 71/231 (31%)
OBF_DNA_ligase_III 460..598 CDD:153436 49/146 (34%)
lig-1NP_741625.2 DNA_ligase_A_N 20..190 CDD:282522 38/177 (21%)
dnl1 77..617 CDD:273147 158/576 (27%)
Adenylation_DNA_ligase_I_Euk 252..468 CDD:185710 72/233 (31%)
OBF_DNA_ligase_I 473..618 CDD:153438 49/152 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1793
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D274264at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.