DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DNAlig3 and K07C5.3

Sequence 1:NP_650187.2 Gene:DNAlig3 FlyBaseID:FBgn0286075 Length:806 Species:Drosophila melanogaster
Sequence 2:NP_505659.1 Gene:K07C5.3 WormBaseID:WBGene00010626 Length:493 Species:Caenorhabditis elegans

Alignment Length:249 Identity:64/250 (26%)
Similarity:121/250 (48%) Gaps:31/250 (12%)


  Fly    28 NEDNKLDTFR---RICDEIAGESSYLKKAERLQRFFEKGSSGKGFKGDTVLWVQFLIPAANQRVY 89
            ||::..::|.   ::|..:...|...:|:..:....:|    |.|.||.:||:.|||..::||.|
 Worm   158 NEESDFNSFYKFVKVCSVLKEISVKSEKSAVITSLLQK----KNFDGDLMLWLTFLIRESDQRSY 218

  Fly    90 NLQNKALIKLFSRIFNADQQQMHLDLEQDGDVSETLRKHFAASKKLKPQKQSKLYLQEVEEMLLH 154
            |:.::.||:.|::|.:..:.::...:.:..|::.:: .| |..||:..:| .|..||:::..|..
 Worm   219 NITDEKLIQYFAKILDMGESKIQKYVTKSNDIALSI-SH-AHEKKVTNEK-GKWSLQKLDRYLEK 280

  Fly   155 LVERTKEDEQTDLLQKLCSKATDLDLRTFIRLVKHDLRINARARHILDAFGPDAYPAYQSSRDLV 219
            |.:...:|.....|:....:....:|...|||::.:|..:|.|..||....|.|...:||: .|.
 Worm   281 LSKIEDDDAILSHLKFAAKRMRHDELDILIRLIRKELDTDADASIILKGVHPKAPEIFQSN-GLD 344

  Fly   220 AIVEQFATKENKNYASSPVKKTKKTSSSAIQVMTPISPMLASPCKSVEDAFKKS 273
            :::|::...:.:..|.      :|||||..:|..|              :||||
 Worm   345 SVIEKYYNNDFEKSAQ------QKTSSSKNKVAEP--------------SFKKS 378

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DNAlig3NP_650187.2 DNA_ligase_A_N 36..200 CDD:282522 42/167 (25%)
dnl1 88..604 CDD:273147 46/187 (25%)
Adenylation_DNA_ligase_III 242..454 CDD:185712 11/33 (33%)
OBF_DNA_ligase_III 460..598 CDD:153436
K07C5.3NP_505659.1 zf-PARP 13..100 CDD:279039
DNA_ligase_A_N 165..317 CDD:282522 39/159 (25%)
SDA1 <376..>445 CDD:283052 3/4 (75%)
zf-CCHH 471..490 CDD:287283
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C105345156
eggNOG 1 0.900 E1_COG1793
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S3614
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3850
TreeFam 00.000 Not matched by this tool.
54.720

Return to query results.
Submit another query.