DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DNAlig3 and lig-4

Sequence 1:NP_650187.2 Gene:DNAlig3 FlyBaseID:FBgn0286075 Length:806 Species:Drosophila melanogaster
Sequence 2:NP_498653.2 Gene:lig-4 WormBaseID:WBGene00002986 Length:741 Species:Caenorhabditis elegans

Alignment Length:836 Identity:171/837 (20%)
Similarity:299/837 (36%) Gaps:204/837 (24%)


  Fly    30 DNKLDTFRRICDEIAGESSYLKKAERLQRFFEKGSSGKGFKGDTVLWVQFLIPAANQ-RVYNLQN 93
            |..:|.|    ::|...|:...|....|:.||..........|..:.::|.:....: |.:::..
 Worm     8 DEVVDVF----NKIRRTSNVKSKQATFQKNFESWKEKCSDPSDMFVIIRFFVSDYERFRKFDMGP 68

  Fly    94 KALIKLFSRIFNADQQQMHLDLEQDGDVSETLRKHFAASKKLKPQKQSKLY-----------LQE 147
            ..|....::.|:          :...|...|:.|..:.:.:...:|.|:.|           :.|
 Worm    69 TKLASFMAKTFH----------DVRADYVSTISKDASTAARQLAEKISEEYRTENDESTVVTVSE 123

  Fly   148 VEEMLLHLVERTKED-EQTDLLQKLCSKATDLDLRTFIRLVKHDLR--INARARHILDAFGPDAY 209
            :.|:|..|.....:| .:.|.:.||..:.::.:|.....::..::.  :.|.:..|||...|.|.
 Worm   124 LNEILDFLAAGPMDDGNKRDKMSKLVKRCSEDELEWIFNVILKNVESALGAPSNRILDWISPSAC 188

  Fly   210 PAYQSSRDLVAIVEQFATKENKNYASSPVKKTKKTSSSAI-QVMTPISPMLASPCK------SVE 267
            ..:..:.||.|:::   .|..:|..::.:.:|.......: ::.|   |||....|      ::|
 Worm   189 AIWDQTHDLKAVLK---GKLVENKGTNELGETNDDDDEHLFKIWT---PMLLQKQKRGDWYANIE 247

  Fly   268 DAFKKSPTGLYSEIKYDGERVQIHKQGNDFKFFSRN----LKPVVDHK--IRALKKYIPQAFPGG 326
               |......:.:.|:|||.|.:||:||::::|:||    .|...|..  |..|...|...|...
 Worm   248 ---KFGGQKFFLQTKFDGENVLLHKKGNEYRWFTRNNNDFSKEYGDSSMAIGKLSSRIHSFFNKE 309

  Fly   327 GE-MILDSEIILVDTDTGALLPFGSLGA----------HKKQTFANAAVCLFVFDCILYDGEDLT 380
            .| .|.:.|::|.|..|..|........          |.|.. .|..:.:.:||.:..:|:...
 Worm   310 CESAIFNCELMLWDKKTKKLCRHNDASTTSDAQVLSFRHVKPD-DNQQLTVVLFDLLYLNGKPFF 373

  Fly   381 QLPFRKRREILEQNIQPIK----------SHVQLSESEFLKTTRELAAMTARVLHANLEGVVLKS 435
            ..|..:|.|:|:  |.|:|          .|.:.|:.|.::...|:|      :..|.||:|:|.
 Worm   374 GAPLHQRLEMLK--IAPLKKEREDTIFVAKHEEGSKKEDIQQFFEIA------MANNEEGIVVKR 430

  Fly   436 PTSTYQPGKRN----WLKVKKDYLFDGKMADTADLVVLGAWYGSGKKGGTLSIFLMGCYDAFGRL 496
            ..|.|..|:|:    |.|:|.....|..:    ||.::....|:|:.|.||  :....:|...:.
 Worm   431 TDSVYVKGQRSASNGWFKLKPSASKDCDL----DLALVAVHPGAGRNGKTL--YRFAAFDEKTQD 489

  Fly   497 WKTVTKVHSGLDDATNAEVHKSLIKLTERADANAIPSWLLCSKSLVPDVL---AKDP-------- 550
            :|.......||.|.....:.....:|.|.|                |:.|   .|.|        
 Worm   490 YKLCLSCSYGLSDTVREAIRFEYGQLLEEA----------------PEELTFYGKRPKNIARGDG 538

  Fly   551 --MKMPVWEITGAEFTKSDAHTASGI---SVRFPRITRRRSDKSAKEANDLAHLEDLFEASKSNV 610
              :....|::...        |::|:   .:..|.:...|.||..::.|......|.        
 Worm   539 GYIDFERWQVIKI--------TSNGVRNGKLVDPVMREWRLDKPVEQVNTWEEFSDY-------- 587

  Fly   611 NVDLLLANCSKDETAMNNKTTPEKEKKLNGNQSNGSKKLKRSNTGSDDEDGAPVLSK--RKESKA 673
                               .|..:|.||..|..:..:         |.||..|...|  |...||
 Worm   588 -------------------ATKVQECKLGDNVDSDEE---------DSEDKKPDTLKVERITRKA 624

  Fly   674 IRSLSPSQKGLKDFFKPSKEFKSVVKKEPKEDEGNIESTSSKPQLFEGLVAHFAME-----KDSS 733
            |...:|.:      .|.:|...|:...|....:|..|:...|   .|.::.||...     ..|:
 Worm   625 IHQSAPVR------LKRAKLESSLTGIEVAVLQGTSETIRRK---CEEILKHFDATVVKGITPST 680

  Fly   734 KLMQQFSQHGGCCTTEPQKADLVFYANTNEALDLEKLRTLYRRSCRHLNVSWLQSC 789
            ||         |..|.|:..    :..|.:|        :...||..|..:||:.|
 Worm   681 KL---------CIATAPKST----HPKTAQA--------IASNSCTVLKPAWLERC 715

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DNAlig3NP_650187.2 DNA_ligase_A_N 36..200 CDD:282522 28/179 (16%)
dnl1 88..604 CDD:273147 120/584 (21%)
Adenylation_DNA_ligase_III 242..454 CDD:185712 62/250 (25%)
OBF_DNA_ligase_III 460..598 CDD:153436 27/154 (18%)
lig-4NP_498653.2 DNA_ligase_A_N 7..167 CDD:282522 29/173 (17%)
Adenylation_DNA_ligase_IV 218..451 CDD:185713 62/248 (25%)
NHEJ_ligase_lig 259..578 CDD:274295 82/358 (23%)
OBF_DNA_ligase_family 459..582 CDD:298752 27/153 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1793
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D189866at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.