DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DNAlig3 and Lig3

Sequence 1:NP_650187.2 Gene:DNAlig3 FlyBaseID:FBgn0286075 Length:806 Species:Drosophila melanogaster
Sequence 2:XP_006532410.1 Gene:Lig3 MGIID:109152 Length:1066 Species:Mus musculus

Alignment Length:697 Identity:320/698 (46%)
Similarity:429/698 (61%) Gaps:47/698 (7%)


  Fly    14 TRLLCNKMASKGLHNEDNKLDTFRRICDEIAGESSYLKKAERLQRFFEKGSSGKGFKGDTVLWVQ 78
            |.|..:|...|   ::|..|..||::|..:|...||..|.:.:..|.:|||:|.||.||..|.|:
Mouse   303 TSLSASKCDPK---HKDCLLREFRKLCAMVAENPSYNTKTQIIHDFLQKGSTGDGFHGDVYLTVK 364

  Fly    79 FLIPAANQRVYNLQNKALIKLFSRIFNADQQQMHLDLEQDGDVSETLRKHFAASKKLKPQKQSKL 143
            .|:|...:.||||.:|.::||||||||.:...|..|||| ||||||:|..|..||...|..:|.|
Mouse   365 LLLPGVIKSVYNLNDKQIVKLFSRIFNCNPDDMARDLEQ-GDVSETIRIFFEQSKSFPPAAKSLL 428

  Fly   144 YLQEVEEMLLHLVERTKEDEQTDLLQKLCSKATDLDLRTFIRLVKHDLRINARARHILDAFGPDA 208
            .:|||:..||||.:.||||||...||.:.|:.|..||:..|||:||||::|:.|:|:|||..|:|
Mouse   429 TIQEVDAFLLHLSKLTKEDEQQQALQDIASRCTANDLKCIIRLIKHDLKMNSGAKHVLDALDPNA 493

  Fly   209 YPAYQSSRDLVAIVEQFATKENKNYASSPVKKTKKTSSSAIQVMTPISPMLASPCKSVEDAFKKS 273
            |.|:::||:|..:||:....|.:.......::..:..:|   :|||:.||||..|||:|.|.||.
Mouse   494 YEAFKASRNLQDVVERVLHNEQEVEKDPGRRRALRVQAS---LMTPVQPMLAEACKSIEYAMKKC 555

  Fly   274 PTGLYSEIKYDGERVQIHKQGNDFKFFSRNLKPVVDHKIRALKKYIPQAFPGGGEMILDSEIILV 338
            |.|::|||||||||||:||:|:.|.:|||:||||:.||:...|.|||:|||||..||||||::|:
Mouse   556 PNGMFSEIKYDGERVQVHKKGDHFSYFSRSLKPVLPHKVAHFKDYIPKAFPGGQSMILDSEVLLI 620

  Fly   339 DTDTGALLPFGSLGAHKKQTFANAAVCLFVFDCILYDGEDLTQLPFRKRREILEQNIQPIKSHVQ 403
            |.:||..||||:||.|||..|.:|.|||||||||.::...|...|..:||:.|..|:..|::.:.
Mouse   621 DNNTGKPLPFGTLGVHKKAAFQDANVCLFVFDCIYFNDVSLMDRPLCERRKFLHDNMVEIRNRIM 685

  Fly   404 LSESEFLKTTRELAAMTARVLHANLEGVVLKSPTSTYQPGKRNWLKVKKDYLFDGKMADTADLVV 468
            .||.:.:....:||.|..||:...|||:|||....||:||||:|||||||||.:|.|||||||||
Mouse   686 FSEMKQVTKASDLADMINRVIREGLEGLVLKDVKGTYEPGKRHWLKVKKDYLNEGAMADTADLVV 750

  Fly   469 LGAWYGSGKKGGTLSIFLMGCYDAFGRLWKTVTKVHSGLDDATNAEVHKSLIKLTERADANAIPS 533
            |||:||.|.|||.:|||||||||...:.|.||||...|.||||.|.:.|.|:.:....|.:.|||
Mouse   751 LGAFYGQGSKGGMMSIFLMGCYDPDSQKWCTVTKCAGGHDDATLARLQKELVMVKISKDPSKIPS 815

  Fly   534 WLLCSKSLVPDVLAKDPMKMPVWEITGAEFTKSDAHTASGISVRFPRITRRRSDKSAKEANDLAH 598
            ||..:|...||.:..||.|..|||||||||::|:||||.|||:||||.||.|.||..|.|.:|..
Mouse   816 WLKINKIYYPDFIVPDPKKAAVWEITGAEFSRSEAHTADGISIRFPRCTRIRDDKDWKSATNLPQ 880

  Fly   599 LEDLFEASKSNVNVDLLLANCSKDETAMNN-------------KTTPEK--------EKKLNGNQ 642
            |::|::.||...:..::..:.:...|..::             |..|.|        |:|||...
Mouse   881 LKELYQLSKDKADFAVVAGDEASPTTGGSSGENEGTAGSAGPCKGPPSKSSASAKTTEQKLNSPS 945

  Fly   643 SNGSKKLKRSNTGSDDEDGAPVLS----KRKESKAIRSLSPSQKGLK 685
            |.|..|              |:..    |..|..|::| ||.:.|:|
Mouse   946 SRGGIK--------------PIPKHSPMKPGEKLAVKS-SPVKVGMK 977

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DNAlig3NP_650187.2 DNA_ligase_A_N 36..200 CDD:282522 80/164 (49%)
dnl1 88..604 CDD:273147 272/516 (53%)
Adenylation_DNA_ligase_III 242..454 CDD:185712 113/212 (53%)
OBF_DNA_ligase_III 460..598 CDD:153436 81/138 (59%)
Lig3XP_006532410.1 zf-PARP 152..232 CDD:279039
DNA_ligase_A_N 320..485 CDD:282522 80/166 (48%)
dnl1 374..886 CDD:273147 272/516 (53%)
Adenylation_DNA_ligase_III 524..736 CDD:185712 113/215 (53%)
OBF_DNA_ligase_III 742..880 CDD:153436 81/138 (59%)
LIG3_BRCT 990..1061 CDD:293364
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C322366840
eggNOG 1 0.900 E1_COG1793
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H32109
Inparanoid 1 1.050 579 1.000 Inparanoid score I1018
Isobase 1 0.950 0 Normalized mean entropy S3614
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D189866at33208
OrthoFinder 1 1.000 FOG0007850
OrthoInspector 1 1.000 T1084156
orthoMCL 1 0.900 OOG5_134498
Panther 1 1.100 LDO PTHR45674
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3850
TreeFam 1 0.960
1312.740

Return to query results.
Submit another query.