DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DNAlig3 and Lig1

Sequence 1:NP_650187.2 Gene:DNAlig3 FlyBaseID:FBgn0286075 Length:806 Species:Drosophila melanogaster
Sequence 2:NP_001076657.1 Gene:Lig1 MGIID:101789 Length:932 Species:Mus musculus

Alignment Length:439 Identity:130/440 (30%)
Similarity:193/440 (44%) Gaps:92/440 (21%)


  Fly   254 PISPMLASPCKSVEDAFKK-SPTGLYSEIKYDGERVQIH-KQGNDFKFFSRNLK------PVVDH 310
            |:.||||.|.:.|.:..|: .......|.||||:|.||| .:|.:.|.||||.:      |.:..
Mouse   553 PLKPMLAHPTRGVSEVLKRFEEVDFTCEYKYDGQRAQIHVLEGGEVKIFSRNQEDNTGKYPDIIS 617

  Fly   311 KIRALKKYIPQAFPGGGEMILDSEIILVDTDTGALLPFGSLGAHKKQ----TFANAAVCLFVFDC 371
            :|..:|      .|.....|||:|.:..|.:...:.||..|...|::    :.....|||:.||.
Mouse   618 RIPKIK------HPSVTSFILDTEAVAWDREKKQIQPFQVLTTRKRKEVDASEIQVQVCLYAFDL 676

  Fly   372 ILYDGEDLTQLPFRKRREILEQNIQPIKSHVQLSESEFLKTTRELAAMTARVLHANLEGVVLKS- 435
            |..:||.|.:.|..:||::|.:|....:.....:.|...|.|.::|....:.:..:.||:::|: 
Mouse   677 IYLNGESLVRQPLSRRRQLLRENFVETEGEFVFTTSLDTKDTEQIAEFLEQSVKDSCEGLMVKTL 741

  Fly   436 -PTSTYQPGKR--NWLKVKKDYLFDGKMADTADLVVLGAWYGSGKKGGTLSIFLMGCYDAFGRLW 497
             ..:||:..||  ||||:||||| || :.||.||||:||:.|.||:.|....||:..||......
Mouse   742 DVDATYEIAKRSHNWLKLKKDYL-DG-VGDTLDLVVIGAYLGRGKRAGRYGGFLLAAYDEESEEL 804

  Fly   498 KTVTKVHSGLDDATNAEVHKSLIKLT-------ERADANAIPS-WLLCSKSLVPDVLAKDPMKMP 554
            :.:.|:.:|..|....|.|:||..|.       .|.|....|. ||             ||  ..
Mouse   805 QAICKLGTGFSDEELEEHHQSLQALVLPTPRPYVRIDGAVAPDHWL-------------DP--SI 854

  Fly   555 VWEITGAEFTKSDAHTAS--------GISVRFPRITRRRSDKSAKEANDLAHLEDLFEASKSNVN 611
            |||:..|:.:.|..:.|:        |||:||||..|.|.||..::|.....:..|:        
Mouse   855 VWEVKCADLSLSPIYPAARGLVDKEKGISLRFPRFIRVRKDKQPEQATTSNQVASLY-------- 911

  Fly   612 VDLLLANCSKDETAMNNKTTPEKEKKLNGNQSNGSKKLKRSNTGSDDED 660
                                 .|:.::...||        |:..||.||
Mouse   912 ---------------------RKQSQIQNQQS--------SDLDSDVED 931

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DNAlig3NP_650187.2 DNA_ligase_A_N 36..200 CDD:282522
dnl1 88..604 CDD:273147 122/382 (32%)
Adenylation_DNA_ligase_III 242..454 CDD:185712 68/216 (31%)
OBF_DNA_ligase_III 460..598 CDD:153436 49/154 (32%)
Lig1NP_001076657.1 PLN03113 187..928 CDD:215584 127/435 (29%)
DNA_ligase_A_N 302..473 CDD:282522
Adenylation_DNA_ligase_I_Euk 545..763 CDD:185710 68/216 (31%)
OBF_DNA_ligase_I 768..913 CDD:153438 50/189 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1793
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.