DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DNAlig3 and LOC101731611

Sequence 1:NP_650187.2 Gene:DNAlig3 FlyBaseID:FBgn0286075 Length:806 Species:Drosophila melanogaster
Sequence 2:XP_004920869.2 Gene:LOC101731611 ID: Length:134 Species:Xenopus tropicalis

Alignment Length:132 Identity:38/133 (29%)
Similarity:63/133 (47%) Gaps:18/133 (14%)


  Fly   258 MLASPCKSVEDAFKKSPTGLYS-EIKYDGERVQIH-KQGNDFKFFSRNLK------PVVDHKIRA 314
            |||.|.|.:.:..|:.....:: |.||||||.||| .:..:...:|||.:      |.:..:|..
 Frog     1 MLAHPTKGIGEVLKRFDEAAFTCEYKYDGERAQIHILENGEVHIYSRNQENNTTKYPDIISRIPK 65

  Fly   315 LKKYIPQAFPGGGEMILDSEIILVDTDTGALLPFGSLGAHKKQ----TFANAAVCLFVFDCILYD 375
            :||...::      .|||:|.:..|.:...:.||..|...|::    :.....||::.||.:..:
 Frog    66 IKKESVKS------CILDTEAVAWDPEKKQIQPFQVLTTRKRKDVDASEIKVQVCVYAFDMLYLN 124

  Fly   376 GE 377
            ||
 Frog   125 GE 126

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DNAlig3NP_650187.2 DNA_ligase_A_N 36..200 CDD:282522
dnl1 88..604 CDD:273147 38/133 (29%)
Adenylation_DNA_ligase_III 242..454 CDD:185712 38/133 (29%)
OBF_DNA_ligase_III 460..598 CDD:153436
LOC101731611XP_004920869.2 Adenylation_DNA_ligase_I_Euk 1..>132 CDD:185710 38/133 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D274264at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.