DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DNAlig3 and LOC100911727

Sequence 1:NP_650187.2 Gene:DNAlig3 FlyBaseID:FBgn0286075 Length:806 Species:Drosophila melanogaster
Sequence 2:XP_008757316.1 Gene:LOC100911727 RGDID:6491367 Length:857 Species:Rattus norvegicus

Alignment Length:439 Identity:127/440 (29%)
Similarity:192/440 (44%) Gaps:92/440 (21%)


  Fly   254 PISPMLASPCKSVEDAFKK-SPTGLYSEIKYDGERVQIH-KQGNDFKFFSRNLK------PVVDH 310
            |:.||||.|.:.|.:..|: .......|.||||:|.||| .:|.:.|.||||.:      |.:..
  Rat   478 PLKPMLAHPTRGVREVLKRFEEVDFTCEYKYDGQRAQIHVLEGGEVKIFSRNQEDNSGKYPDIIS 542

  Fly   311 KIRALKKYIPQAFPGGGEMILDSEIILVDTDTGALLPFGSLGAHKKQ----TFANAAVCLFVFDC 371
            :|..:|      .|.....|||:|.:..|.:...:.||..|...|::    :.....|||:.||.
  Rat   543 RIPKIK------HPSVTSFILDTEAVAWDREKKQIQPFQVLTTRKRKEVDASEIQVQVCLYAFDL 601

  Fly   372 ILYDGEDLTQLPFRKRREILEQNIQPIKSHVQLSESEFLKTTRELAAMTARVLHANLEGVVLKS- 435
            |..:||.|.:.|..:||::|.:|....:.....:.|...|...::|....:.:..:.||:::|: 
  Rat   602 IYLNGESLARQPLSRRRQLLRENFVETEGEFVFATSLDTKDIEQIAEFLEQSVKDSCEGLMVKTL 666

  Fly   436 -PTSTYQPGKR--NWLKVKKDYLFDGKMADTADLVVLGAWYGSGKKGGTLSIFLMGCYDAFGRLW 497
             ..:||:..||  ||||:||||| :| :.||.||||:||:.|.||:.|....||:..||......
  Rat   667 DVDATYEIAKRSHNWLKLKKDYL-EG-VGDTLDLVVIGAYLGRGKRAGRYGGFLLAAYDEESEEL 729

  Fly   498 KTVTKVHSGLDDATNAEVHKSLIKLT-------ERADANAIPS-WLLCSKSLVPDVLAKDPMKMP 554
            :.:.|:.:|..|....|.|:|:..|.       .|.|....|. ||             ||  ..
  Rat   730 QAICKLGTGFSDEELEEHHQSMQALLLPTPRPYVRIDGAVAPDHWL-------------DP--SV 779

  Fly   555 VWEITGAEFTKSDAHTAS--------GISVRFPRITRRRSDKSAKEANDLAHLEDLFEASKSNVN 611
            |||:..|:.:.|..:.|:        |||:||||..|.|.||..::|.....:..|:        
  Rat   780 VWEVKCADLSLSPIYPAARGLVDKEKGISLRFPRFIRVREDKQPEQATTSDQVASLY-------- 836

  Fly   612 VDLLLANCSKDETAMNNKTTPEKEKKLNGNQSNGSKKLKRSNTGSDDED 660
                                 .|:.::...||        |:..||.||
  Rat   837 ---------------------RKQSQIQNQQS--------SDLDSDVED 856

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DNAlig3NP_650187.2 DNA_ligase_A_N 36..200 CDD:282522
dnl1 88..604 CDD:273147 119/382 (31%)
Adenylation_DNA_ligase_III 242..454 CDD:185712 67/216 (31%)
OBF_DNA_ligase_III 460..598 CDD:153436 48/154 (31%)
LOC100911727XP_008757316.1 PLN03113 103..853 CDD:215584 124/435 (29%)
DNA_ligase_A_N 227..398 CDD:282522
Adenylation_DNA_ligase_I_Euk 470..688 CDD:185710 67/216 (31%)
OBF_DNA_ligase_I 693..838 CDD:153438 49/189 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1793
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D274264at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.