DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DNAlig3 and lig1

Sequence 1:NP_650187.2 Gene:DNAlig3 FlyBaseID:FBgn0286075 Length:806 Species:Drosophila melanogaster
Sequence 2:XP_002941929.1 Gene:lig1 XenbaseID:XB-GENE-1009779 Length:1040 Species:Xenopus tropicalis

Alignment Length:685 Identity:179/686 (26%)
Similarity:288/686 (42%) Gaps:153/686 (22%)


  Fly    35 TFRRICDEIAGESSYLKKAERLQRFFEKGSSGKGFKGDTV----LWVQFLIPAANQRVYNLQNKA 95
            ||.||.:    ||:.||..|.|..|..  |......||.:    |.:..|.||.......:....
 Frog   418 TFERIEE----ESARLKNIETLSNFLR--SVIALTPGDLLPCIYLCLNRLGPAYEGLELGIGETI 476

  Fly    96 LIKLFSRIFNADQQQMHLDLEQDGD---VSETLRKH----FAASKKLKPQKQSKLYLQEVEEMLL 153
            |:|..::......:::..:.::.||   |:|:.|.:    |...|.:.....|||      :.:.
 Frog   477 LMKAVAQATGRQLEKIKSEAQEKGDLGLVAESSRSNQRTMFTPPKLMASGVFSKL------KDIA 535

  Fly   154 HLVERTKEDEQTDLLQKLCSKATDLDLRTFIRLVKHDLRINARARHILDAF---------GPDAY 209
            .:......:::.|:::.|.......:.|...|.:...|||....:.:|.|.         |.||.
 Frog   536 RMTGNASMNKKIDIIKGLFVACRHSEARYIARSLGGKLRIGLAEQSVLSAIAQAVCLTPPGHDAP 600

  Fly   210 PAYQSS-------------RDLVAIVEQ-FATKENKNY-ASSPV----------KKTKKTSSSAI 249
            |....:             .|...|::| |.  |..|| |..|:          |..:.|..   
 Frog   601 PTVMDAGKGMSTDARKSWIEDKAMILKQTFC--ELPNYDAIIPILLEHGIDDLPKHCRLTPG--- 660

  Fly   250 QVMTPISPMLASPCKSVEDAFKKSPTGLYS-EIKYDGERVQIH-KQGNDFKFFSRNLK------P 306
               .|:.||||.|.|.:.:..|:.....:: |.||||||.||| .:..:...:|||.:      |
 Frog   661 ---IPLKPMLAHPTKGIGEVLKRFDEAAFTCEYKYDGERAQIHILENGEVHIYSRNQENNTTKYP 722

  Fly   307 VVDHKIRALKKYIPQAFPGGGEMILDSEIILVDTDTGALLPFGSLGAHKKQ----TFANAAVCLF 367
            .:..:|..:||...::      .|||:|.:..|.:...:.||..|...|::    :.....||::
 Frog   723 DIISRIPKIKKESVKS------CILDTEAVAWDPEKKQIQPFQVLTTRKRKDVDASEIKVQVCVY 781

  Fly   368 VFDCILYDGEDLTQLPFRKRREILEQNIQPIKSHVQLSESEFL-------KTTRELAAMTARVLH 425
            .||.:..:||.|.:.||.|||::|..:...       :|.||:       ..|.|::....:.:.
 Frog   782 AFDMLYLNGESLVKEPFAKRRQLLRDSFLE-------TEGEFMFATYMDTSNTDEISEFLDQSIK 839

  Fly   426 ANLEGVVLKS--PTSTYQPGKR--NWLKVKKDYLFDGKMADTADLVVLGAWYGSGKKGGTLSIFL 486
            .:.||:::|:  ..:||:..||  ||||:||||| :| :.||.||||:||:.|.||:.|....||
 Frog   840 DSCEGLMVKTLEQDATYEIAKRSHNWLKLKKDYL-EG-VGDTLDLVVIGAYLGKGKRTGIYGGFL 902

  Fly   487 MGCYDAFGRLWKTVTKVHSGLDDATNAEVHKSLIK--------LTERADANAIPS-WLLCSKSLV 542
            :..||.....::|:.|:.:|..| .:.|.|.:.:|        ...|.|:...|. |.       
 Frog   903 LASYDEESEEYQTICKIGTGFTD-EDLEKHYNYLKDHVIDSPRSYYRWDSATEPDHWF------- 959

  Fly   543 PDVLAKDPMKMPVWEITGAEFTKSDAHTAS--------GISVRFPRITRRRSDKSAKEANDLAHL 599
                  ||::  |||:..|:.:.|..|.|:        |||:||||..|.|.||..:||.:...:
 Frog   960 ------DPVQ--VWEVKCADLSISPVHKAALGLVEDEKGISLRFPRFLRIRDDKKPEEATNSFQV 1016

  Fly   600 EDLFEASKSNVNVDLLLANCSKDETAMNNKTTPEK 634
            .||:                 :.:..:.|.||.||
 Frog  1017 ADLY-----------------RKQQQIQNTTTTEK 1034

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DNAlig3NP_650187.2 DNA_ligase_A_N 36..200 CDD:282522 36/175 (21%)
dnl1 88..604 CDD:273147 156/597 (26%)
Adenylation_DNA_ligase_III 242..454 CDD:185712 67/235 (29%)
OBF_DNA_ligase_III 460..598 CDD:153436 49/155 (32%)
lig1XP_002941929.1 PLN03113 268..1020 CDD:215584 174/653 (27%)
DNA_ligase_A_N 411..582 CDD:282522 37/176 (21%)
Adenylation_DNA_ligase_I_Euk 654..872 CDD:185710 67/237 (28%)
OBF_DNA_ligase_I 877..1022 CDD:153438 51/178 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1793
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D274264at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.