DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34402 and TLL1

DIOPT Version :9

Sequence 1:NP_001097756.1 Gene:CG34402 / 41513 FlyBaseID:FBgn0085431 Length:695 Species:Drosophila melanogaster
Sequence 2:NP_036596.3 Gene:TLL1 / 7092 HGNCID:11843 Length:1013 Species:Homo sapiens


Alignment Length:765 Identity:137/765 - (17%)
Similarity:246/765 - (32%) Gaps:261/765 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SFTVSHWPLTM-PAASLALGLTVV------------------------LLATGNGQSQQAVTNSK 43
            |:|...|.::: |...:.|..|.:                        ||....|.....|..|.
Human   371 SYTHCIWRVSVTPGEKIVLNFTTMDLYKSSLCWYDYIEVRDGYWRKSPLLGRFCGDKLPEVLTST 435

  Fly    44 QSHFWLDCSCLHLSERNATQW----------------------------------------GRLA 68
            .|..|::.       |:::.|                                        .::.
Human   436 DSRMWIEF-------RSSSNWVGKGFAAVYEAICGGEIRKNEGQIQSPNYPDDYRPMKECVWKIT 493

  Fly    69 INASHSLGAKNNCLMIFIAGMDDELVAFQLEQLQLRAGCLDSVDIFPYL--REPVIENATLAADT 131
            ::.|:.:|                 :.||..:::....|     .:.||  |:...||:.|.. .
Human   494 VSESYHVG-----------------LTFQSFEIERHDNC-----AYDYLEVRDGTSENSPLIG-R 535

  Fly   132 FCQHSRERSATPIYSAGRLLGLRLRFQQPPTDLASWNLTLNASYRFLKRENFRTDGRLVPHSF-- 194
            ||.:.:                       |.|:.|.:.||     ::|   |.:||.:....|  
Human   536 FCGYDK-----------------------PEDIRSTSNTL-----WMK---FVSDGTVNKAGFAA 569

  Fly   195 ----------------CDFYFFASLSGEEANMGQGY-----------------------FHSPQF 220
                            |:.....:|...:.....||                       ..:|.:
Human   570 NFFKEEDECAKPDRGGCEQRCLNTLGSYQCACEPGYELGPDRRSCEAACGGLLTKLNGTITTPGW 634

  Fly   221 PAHYPAHIKCAYKFIGRPDTHVEILFEELQLPPVVSGG--CQLDALTLFDAESAHMNSVIDVICS 283
            |..||.:..|.::.:......:.:.||..:|    .|.  |:.|.:.::...|:. :.:....|.
Human   635 PKEYPPNKNCVWQVVAPTQYRISVKFEFFEL----EGNEVCKYDYVEIWSGLSSE-SKLHGKFCG 694

  Fly   284 SRPTRRLVSTGPDLLLEFNASSNRTAKGFRGKYKFVSNDLGVPNASVPPPAVLEAASVVVKQEKL 348
            :.....:.|...::.:||.:.:..:.|||:..: |...|                          
Human   695 AEVPEVITSQFNNMRIEFKSDNTVSKKGFKAHF-FSDKD-------------------------- 732

  Fly   349 QQEQASAAKENSLMSDVELSKPGRSFEQCKQTFDSRVNKSGIFDS--NQLLLAKHALGGVVIG-- 409
                 ..:|:|.......::..|....||:..|....||....::  .|.:   |:..|::..  
Human   733 -----ECSKDNGGCQHECVNTMGSYMCQCRNGFVLHDNKHDCKEAECEQKI---HSPSGLITSPN 789

  Fly   410 -----GSRVLQCRYEFEAQAPERVQIRFHDFNVPTEHENSTGCQPGDALHVV---TE---LRGRY 463
                 .|| .:|.:|..|....|:::.|.:|.:....|.:.     |.|.|.   ||   :.|| 
Human   790 WPDKYPSR-KECTWEISATPGHRIKLAFSEFEIEQHQECAY-----DHLEVFDGETEKSPILGR- 847

  Fly   464 ETQELLCGAFLPKPLMSSGQQLHLQFVGKYPPTMTNKVQYYGFRAEYRFLTNFGIMSGIQKEGCS 528
                 |||..:|.||:::|.::.::||.      ...||..||:|.:.  |..|.....:.:...
Human   848 -----LCGNKIPDPLVATGNKMFVRFVS------DASVQRKGFQATHS--TECGGRLKAESKPRD 899

  Fly   529 FVYNSSERISGLFHSPNFPGYYLENVVCNYYFYGASDERVVLHFTYFDIEGIGSCDHQTASDYIE 593
             :|:.::     |...|:||    .|.|.:........|:.|.|..|::|....|.:    ||:|
Human   900 -LYSHAQ-----FGDNNYPG----QVDCEWLLVSERGSRLELSFQTFEVEEEADCGY----DYVE 950

  Fly   594 -FSNFMSTDRKFSRYCGKLPDFEMRSDGRFFRVTLHSNDRFVAIGFRALY 642
             |....||.....|:||..|..|:.|.|....:..|::|.....||...|
Human   951 LFDGLDSTAVGLGRFCGSGPPEEIYSIGDSVLIHFHTDDTINKKGFHIRY 1000

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34402NP_001097756.1 CUB 195..318 CDD:238001 23/147 (16%)
CUB <414..512 CDD:238001 28/103 (27%)
CUB 527..644 CDD:238001 31/117 (26%)
TLL1NP_036596.3 ZnMc_BMP1_TLD 148..347 CDD:239808
Astacin 155..348 CDD:279708
CUB 349..458 CDD:278839 15/93 (16%)
CUB 462..571 CDD:278839 23/162 (14%)
FXa_inhibition 582..614 CDD:291342 4/31 (13%)
CUB 618..727 CDD:278839 19/113 (17%)
FXa_inhibition 734..769 CDD:291342 8/34 (24%)
CUB 774..883 CDD:278839 33/129 (26%)
CUB 887..1000 CDD:278839 31/126 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.