DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34402 and st14a

DIOPT Version :9

Sequence 1:NP_001097756.1 Gene:CG34402 / 41513 FlyBaseID:FBgn0085431 Length:695 Species:Drosophila melanogaster
Sequence 2:NP_001035441.2 Gene:st14a / 678603 ZFINID:ZDB-GENE-030131-6496 Length:834 Species:Danio rerio


Alignment Length:457 Identity:100/457 - (21%)
Similarity:167/457 - (36%) Gaps:134/457 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   248 ELQLPPVVSGGCQLDALTLFDA----ESAHMNSVIDVICSSRPTRRLVSTGPDLLLEFNASSNRT 308
            :|:|..:.:|..::......||    :|....::.|.:.:.   .:|:.:....|.::..:|...
Zfish    72 DLKLQKIYTGSFRITNEAFVDAYENPQSPEFQNLADKVSTQ---LKLMYSESSQLSKYYVTSRVQ 133

  Fly   309 AKGFRGKYKFVSNDLGVPNASVPPPAVLEAASVVV------KQEKLQQEQASAAKENSLMSDVE- 366
            |........:..::..||.|.  ..||.:|.|.:.      |..|:.::|.|...::.:.|.:: 
Zfish   134 AFSEGSVIAYYESEFAVPAAH--EAAVDQAVSNLSEKYSSGKARKVSEQQGSLVLDSVVSSALDK 196

  Fly   367 --LSKPGRSFEQCKQTFDSRVNKSGIFD---------SNQLLLAKHALGGVVIGGSRVLQCRYEF 420
              :||...|....|.|  ||..:..||.         ||..:                   :::.
Zfish   197 RLISKARSSTRYNKHT--SRFVEDIIFSPGFPDSPYPSNTFV-------------------QWQL 240

  Fly   421 EAQAPERVQIRFHDFNVPTEHENSTGCQPGDALHVVTELRGRYETQELL--------CGAFLPK- 476
            .......:::.|..||:.....|       |.|.|       |::...|        ||.:.|. 
Zfish   241 RGDPDHVLKLTFDTFNLEQNCSN-------DFLRV-------YDSLVALDKFIMAEKCGYYSPSD 291

  Fly   477 PL--MSSGQQLHLQFV----GKYPPTMTNKVQYYGFRAEYRFLTNFGIMSGIQKEGCS--FVYNS 533
            ||  :||...:.:..|    |.||          ||||.         :|.||...|.  .:.| 
Zfish   292 PLSFISSRNVMLVTLVTNEEGAYP----------GFRAR---------VSQIQAVTCGGRMIGN- 336

  Fly   534 SERISGLFHSPNFPGYYLENVVCNYYFYGASDERVVLHFTYFDIEGIGSCDHQTASDYIEFSNFM 598
                ||:|.|||||.||..|:.|.:|....:.:.:.|.|....:.....|.    .|::|...  
Zfish   337 ----SGIFTSPNFPDYYPPNITCQWYIEVPAGKFIKLKFPKIMVSTGSECH----GDFVEVVG-- 391

  Fly   599 STDRKFSRYCGKLPDFEMRSDGRFFRVTLHSND---RFVA------IGFRALYTFETVSVNNSIT 654
                 .|:.||:    ::.:     .||::||.   |||:      .||.|  |||..|.::...
Zfish   392 -----QSKLCGQ----QLNT-----IVTVNSNTATVRFVSDSSNVDRGFSA--TFEDYSPSDPCQ 440

  Fly   655 DL 656
            ||
Zfish   441 DL 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34402NP_001097756.1 CUB 195..318 CDD:238001 11/73 (15%)
CUB <414..512 CDD:238001 24/112 (21%)
CUB 527..644 CDD:238001 33/127 (26%)
st14aNP_001035441.2 SEA 77..168 CDD:279699 16/95 (17%)
CUB 219..322 CDD:238001 28/154 (18%)
CUB 329..431 CDD:238001 34/128 (27%)
LDLa 443..472 CDD:238060 100/457 (22%)
LDLa 474..508 CDD:238060
LDLa 510..544 CDD:238060
LDLa 550..585 CDD:238060
Tryp_SPc 596..828 CDD:214473
Tryp_SPc 597..831 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.