DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sol1 and myl2b

DIOPT Version :10

Sequence 1:NP_001097756.1 Gene:Sol1 / 41513 FlyBaseID:FBgn0085431 Length:695 Species:Drosophila melanogaster
Sequence 2:NP_001035134.1 Gene:myl2b / 677750 ZFINID:ZDB-GENE-060331-137 Length:168 Species:Danio rerio


Alignment Length:60 Identity:15/60 - (25%)
Similarity:25/60 - (41%) Gaps:8/60 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   347 KLQQEQASAAKEN--SLMSDVELSKPGRSFEQCKQTFDSRVNKSGIFDSNQLLLAKHALG 404
            |..:::|..|..|  |:....::    :.|::.....|.  |:.|..|.|.|.....|||
Zfish     4 KKAKKRAEGANSNVFSMFEQAQI----QEFKEAFTIMDQ--NRDGFIDKNDLRDTFAALG 57

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sol1NP_001097756.1 CUB 195..318 CDD:238001
CUB <414..512 CDD:238001
CUB 527..644 CDD:238001
myl2bNP_001035134.1 PTZ00184 20..160 CDD:185504 10/44 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.