DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34402 and CG34370

DIOPT Version :9

Sequence 1:NP_001097756.1 Gene:CG34402 / 41513 FlyBaseID:FBgn0085431 Length:695 Species:Drosophila melanogaster
Sequence 2:NP_001097404.2 Gene:CG34370 / 5740565 FlyBaseID:FBgn0085399 Length:952 Species:Drosophila melanogaster


Alignment Length:354 Identity:83/354 - (23%)
Similarity:141/354 - (39%) Gaps:93/354 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 VPHSFCDFYFFASLSGEEANMGQGYFHSPQFPAH-YPAHIKCAYKFIGRPDTHVEILFEELQLPP 253
            :.|..|| :..:|.|.::::..:|.|.|   .|| ||.:..|:|...|.....|.:.|...::..
  Fly   376 IKHGVCD-WLLSSDSLKDSSASEGIFLS---IAHWYPPNTSCSYHIKGHVGEIVRLYFPSFRINR 436

  Fly   254 VVS------GGCQLDALTLFDAESAHMNSVIDVICS--SRPTRRL--VSTGPDLLLEFNA---SS 305
            :.|      |.|. ::||::|::.|....:|...|.  |||..::  |||.|.|.::|::   |.
  Fly   437 IESPILKYEGDCG-ESLTIYDSDHADPARIIKTFCDTFSRPMEKVDFVSTSPSLYVQFDSKTGSY 500

  Fly   306 NRTAKGFRGKYKFVSND-LGVPNASVPPPAVLEAASVVVKQEKLQQEQASAAKENSLMSDVELS- 368
            :.::..:...|.|.:|. .|.|   ||                           |:|..:|..: 
  Fly   501 SGSSLYYWAHYDFFNNTRFGDP---VP---------------------------NTLCDEVMYAW 535

  Fly   369 -KPGRSFEQCKQTFDSRVNKSGIFDSNQLLLAKHALGGVVIGGSRVLQCRYEF--EAQAPERVQI 430
             .||.....               ..|.|:..:       .|||.| :|:|:|  :.:...|..|
  Fly   536 KHPGGRLRS---------------PLNSLIFKR-------TGGSDV-RCQYKFVTDRRLYARAII 577

  Fly   431 RFHDFNVPTEHENSTGC-----QPGDALHVVTELRGRYETQELLCGAF---LPKP--LMSSGQQL 485
            ..:..:......||..|     :..|.| |:.|.|.:|: ..|.|  |   :|:.  ::||..|:
  Fly   578 EVNSVSFKELPYNSNACTRCHEERVDKL-VIWEERDKYQ-NNLAC--FCDNIPRAVRVISSADQM 638

  Fly   486 HLQFV--GKYPPTMTNKVQYYGFRAEYRF 512
            :|:.:  |::..|...|.....|.|.|.|
  Fly   639 NLEMIVQGQHAITSYFKNPNPLFEATYEF 667

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34402NP_001097756.1 CUB 195..318 CDD:238001 36/136 (26%)
CUB <414..512 CDD:238001 28/111 (25%)
CUB 527..644 CDD:238001
CG34370NP_001097404.2 CUB 88..195 CDD:238001
CUB 244..363 CDD:238001
CUB 407..509 CDD:238001 26/102 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR47537
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.