DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34402 and AgaP_AGAP004160

DIOPT Version :9

Sequence 1:NP_001097756.1 Gene:CG34402 / 41513 FlyBaseID:FBgn0085431 Length:695 Species:Drosophila melanogaster
Sequence 2:XP_562672.3 Gene:AgaP_AGAP004160 / 3290969 VectorBaseID:AGAP004160 Length:331 Species:Anopheles gambiae


Alignment Length:304 Identity:128/304 - (42%)
Similarity:167/304 - (54%) Gaps:29/304 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   383 SRVNKSGIFDSNQLLLAKHALGGVVIGGSRVLQCRYEFEAQAPERVQIRFHDFNVPTEHENSTGC 447
            |....||:|.|:...|                   |||.....|||||.|.:|.:|:. ...|.|
Mosquito    27 SHSKHSGLFPSSLCQL-------------------YEFVGDGAERVQIIFSEFRLPST-LGPTEC 71

  Fly   448 QPGDALHVVTELRGRYETQELLCGAFLPKPLMSSGQQLHLQFVGKYPPTMTNKVQYYGFRAEYRF 512
            ...|.|.|...:.||.|..|.|||..||||::|.|.:|.|:....|     |..:..||..::.|
Mosquito    72 GDTDILMVYYIVNGREELVETLCGDTLPKPILSDGSRLLLELRSSY-----NNTENKGFTGDFFF 131

  Fly   513 LTNFGIMSGIQ--KEGCSFVYNSSERISGLFHSPNFPGYYLENVVCNYYFYGASDERVVLHFTYF 575
            ||||||.:|.|  :..|:|.|..:....|...||||||.|..|::|||.|:|..::.|.:.||||
Mosquito   132 LTNFGIPNGFQPNQSECTFHYFRNVTSQGWIQSPNFPGAYPRNIICNYLFHGGPNDFVHVRFTYF 196

  Fly   576 DIEGIGSCDHQTASDYIEFSNFMSTDRKFSRYCGKLPDFEMRSDGRFFRVTLHSNDRFVAIGFRA 640
            |||||..||..|||||:|||||::.|||::.|||...:..:||||||||:|:.||||....||||
Mosquito   197 DIEGIRPCDEDTASDYVEFSNFVTRDRKYAMYCGSWRELVVRSDGRFFRITMVSNDRLDGTGFRA 261

  Fly   641 LYTFETVSVNNSITDLRDNASMQSFVSTASTQPVANVNKLIACI 684
            |||||||.|..  |:..:.|||....:|::...:.....|:|.|
Mosquito   262 LYTFETVPVET--TERTEVASMGKVTTTSAASRLHGSLSLMALI 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34402NP_001097756.1 CUB 195..318 CDD:238001
CUB <414..512 CDD:238001 35/97 (36%)
CUB 527..644 CDD:238001 64/116 (55%)
AgaP_AGAP004160XP_562672.3 CUB 9..131 CDD:294042 41/128 (32%)
CUB 155..265 CDD:238001 61/109 (56%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 138 1.000 Domainoid score I9927
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H122064
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0017010
OrthoInspector 1 1.000 - - oto107347
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4379
TreeFam 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.