DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sol1 and Mylpf

DIOPT Version :10

Sequence 1:NP_001097756.1 Gene:Sol1 / 41513 FlyBaseID:FBgn0085431 Length:695 Species:Drosophila melanogaster
Sequence 2:NP_058034.1 Gene:Mylpf / 17907 MGIID:97273 Length:169 Species:Mus musculus


Alignment Length:171 Identity:37/171 - (21%)
Similarity:63/171 - (36%) Gaps:35/171 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   347 KLQQEQASAAKENSLMSDVELSKPGRSFEQCKQTFDSRVNKSGIFDSNQLLLAKHALGGVVIGGS 411
            |..:.:|.|...:::.|..:.::. :.|::.....|.  |:.||.|...|.....|:|.:.:...
Mouse     4 KKAKRRAGAEGSSNVFSMFDQTQI-QEFKEAFTVIDQ--NRDGIIDKEDLRDTFAAMGRLNVKNE 65

  Fly   412 RVLQCRYEFEAQAPERVQIRFHDFNVPTEHENSTGCQPGDALHVVT--------ELRGRYETQ-- 466
            . |....: ||..|....:....|.     |...|..|.|   |:|        |.:|..:.|  
Mouse    66 E-LDAMMK-EASGPINFTVFLTMFG-----EKLKGADPED---VITGAFKVLDPEGKGTIKKQFL 120

  Fly   467 -ELL---CGAFLPKPLMSSGQQLHLQFVGKYPPTMTNKVQY 503
             |||   |..|       |.:::...:.. :||.:...|.|
Mouse   121 EELLTTQCDRF-------SQEEIKNMWAA-FPPDVGGNVDY 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sol1NP_001097756.1 CUB 195..318 CDD:238001
CUB <414..512 CDD:238001 24/104 (23%)
CUB 527..644 CDD:238001
MylpfNP_058034.1 PTZ00184 21..157 CDD:185504 33/154 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.