DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD1 and AT3G47680

DIOPT Version :10

Sequence 1:NP_524326.1 Gene:GstD1 / 41503 FlyBaseID:FBgn0001149 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_190352.1 Gene:AT3G47680 / 823922 AraportID:AT3G47680 Length:302 Species:Arabidopsis thaliana


Alignment Length:44 Identity:15/44 - (34%)
Similarity:19/44 - (43%) Gaps:17/44 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YYLPGSSPCRSVIMTAKAVGVELNKKLLNLQAGEHLKPEFLKIN 48
            ||  |:||        |..|||      ..:.| |:|..:.|||
plant    87 YY--GASP--------KLNGVE------KRETG-HIKQRWTKIN 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD1NP_524326.1 GST_N_Delta_Epsilon 2..75 CDD:239343 15/44 (34%)
GST_C_Delta_Epsilon 89..205 CDD:198287
AT3G47680NP_190352.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.