DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstD1 and GstD2

Sequence 1:NP_001034042.1 Gene:GstD1 FlyBaseID:FBgn0001149 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_524912.1 Gene:GstD2 FlyBaseID:FBgn0010038 Length:215 Species:Drosophila melanogaster

Alignment Length:208 Identity:146/209 (70%)
Similarity:171/209 (82%) Gaps:0/209 (0%)


  Fly     2 VDFYYLPGSSPCRSVIMTAKAVGVELNKKLLNLQAGEHLKPEFLKINPQHTIPTLVDNGFALWES 66
            :||||:||...||:|||.|||:|:||||||||...||.|||||:|:||||||||||||||::|||
  Fly     1 MDFYYMPGGGGCRTVIMVAKALGLELNKKLLNTMEGEQLKPEFVKLNPQHTIPTLVDNGFSIWES 65

  Fly    67 RAIQVYLVEKYGKTDSLYPKCPKKRAVINQRLYFDMGTLYQSFANYYYPQVFAKAPADPEAFKKI 131
            |||.|||||||||.|.|.|..|||||||||||||||||||:|||.||||......|...|..|:|
  Fly    66 RAIAVYLVEKYGKDDYLLPNDPKKRAVINQRLYFDMGTLYESFAKYYYPLFRTGKPGSDEDLKRI 130

  Fly   132 EAAFEFLNTFLEGQDYAAGDSLTVADIALVATVSTFEVAKFEISKYANVNRWYENAKKVTPGWEE 196
            |.||.||:||||||:|.|||.|||||||:::|||||||::|:.|||:||:|||:|||||||||:|
  Fly   131 ETAFGFLDTFLEGQEYVAGDQLTVADIAILSTVSTFEVSEFDFSKYSNVSRWYDNAKKVTPGWDE 195

  Fly   197 NWAGCLEFKKYFE 209
            ||.|.:..|..|:
  Fly   196 NWEGLMAMKALFD 208

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstD1NP_001034042.1 GST_N_Delta_Epsilon 2..75 CDD:239343 55/73 (75%)
GstA 4..185 CDD:223698 130/181 (72%)
GST_C_Delta_Epsilon 89..205 CDD:198287 80/116 (69%)
GstD2NP_524912.1 GST_N_Delta_Epsilon 1..74 CDD:239343 55/73 (75%)
GST_C_Delta_Epsilon 88..204 CDD:198287 80/116 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131161066
eggNOG 1 0.900 E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2329
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1231780at2759
OrthoFinder 1 1.000 FOG0000104
orthoMCL 1 0.900 OOG5_126942
Panther 1 1.100 P PTHR43969
RoundUp 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.