DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD1 and GstE2

DIOPT Version :10

Sequence 1:NP_524326.1 Gene:GstD1 / 41503 FlyBaseID:FBgn0001149 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_611324.1 Gene:GstE2 / 37107 FlyBaseID:FBgn0063498 Length:221 Species:Drosophila melanogaster


Alignment Length:96 Identity:25/96 - (26%)
Similarity:34/96 - (35%) Gaps:35/96 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   290 ENLLLTSTMEDG---ATVPTVTSNILEILEDALEEGSGSLESLEKSGNSGEK------------- 338
            |.:|||:.|..|   |.|||.|  ||....|       :|..||.:|.:...             
  Fly   686 EPVLLTTCMPVGNYSALVPTAT--ILNATTD-------TLAGLEAAGYAAYSTALSVTIAIGCSL 741

  Fly   339 ----------LEENRKNRRKSVKSLEHSFEQ 359
                      :...|...|..||||:..::|
  Fly   742 LILNVLIFAGVYYQRDKTRLEVKSLQKQYQQ 772

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD1NP_524326.1 GST_N_Delta_Epsilon 2..75 CDD:239343
GST_C_Delta_Epsilon 89..205 CDD:198287
GstE2NP_611324.1 GstA 5..200 CDD:440390
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.