DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD1 and GstE1

DIOPT Version :10

Sequence 1:NP_524326.1 Gene:GstD1 / 41503 FlyBaseID:FBgn0001149 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_611323.1 Gene:GstE1 / 37106 FlyBaseID:FBgn0034335 Length:224 Species:Drosophila melanogaster


Alignment Length:118 Identity:29/118 - (24%)
Similarity:48/118 - (40%) Gaps:30/118 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 DPQIAIDDVIQESKHIRG-RPFAIEP-PTDLVHVIHVKSDRFPAKNLEKSIYTQEIQEKSENLAE 287
            |..:.:|::||....:|| ||....| |.:.:..:.:||         :.|:.|:     ..|.|
  Fly     3 DYTLDVDNLIQRLLEVRGCRPGKSVPMPEEEIRALCLKS---------REIFLQQ-----PILLE 53

  Fly   288 IDENLL-----------LTSTMEDGATVPTVTSNILEILEDALEEGSGSLESL 329
            ::..|.           |....|.|...|  .:|.| .|.|.::.|..|||::
  Fly    54 LEAPLKICGDIHGQYTDLLRLFEYGGFPP--EANYL-FLGDYVDRGKQSLETI 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD1NP_524326.1 GST_N_Delta_Epsilon 2..75 CDD:239343
GST_C_Delta_Epsilon 89..205 CDD:198287
GstE1NP_611323.1 GstA 6..201 CDD:440390 28/115 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.